1 2 3 4 5 6 7 8 9 ... 40 41 42 43 44 45 46 47 48 49

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Stardust Impressionist Paintings Screen Saver

Freeware by Stardust Software
147 x 2801Kb downloads

...includes Microsoft Plus! style features as well as options that let you play background music, change the...sequence with video and sound, customized screen saver settings dialog box, random eye-drop background colors, and much...
 
screensavergauginimpressionistpaintingsrenoircezannemonet
...policies. Password Assistant gives you a variety of options that helps you to meet and exceed corporate,...generated that are very difficult to break. Numerous options assist you in generating passwords that are easier...in addition to Random word types. Use optional settings for variable password length, use of character types...alter your mix. When youÂ’ve completed your password options and settings, output your passwords to the ClipBoard...
 
loginutilitieswindows securityhackersgeneratedown loadhome networksharewaregeneratorhackingpasswordsprivacysecurefreewareutilitydownloadsdownload software
PDF Bookmark Print

Shareware by Traction Software
18 x 2240Kb downloads

...bookmarks selected to csv file, save and Load settings for later use. NOTE: This Software requires Full...
 
bookmarkspdfprint
Imagicon

Freeware by Devious Codeworks
112 x 1499Kb downloads

Free Vista Files award
...Portable Network Graphics (PNG) and Windows Icon (ICO). Options are available to transform images and enable alpha...with the software, explaining each of the possible settings and the function that they perform....
 
freepngformatimagiconbatchcodeworksbmpjpgdeviousimagewindowsconvert
Ares Galaxy PRO

Freeware by Ares Galaxy Online
419 x 14027Kb downloads

...time of day. There are a few advanced options available via the Preferences dialog. However, there is...
 
file sharing programsfile sharing applicationp2p softwarep2p clientbittorrent clientp2p programdownloadsfilesares galaxy pro editionpeer-to-peer application
SpamAware

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...new incoming mails and decides based on the settings made in options what to do with the...
 
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
EditPad Lite

Freeware by Just Great Software
16 x 9258Kb downloads

...and ink with the powerful print preview, and options like printer font, margins, headers/footers, etc. You can...the many preferences that you can specify. Many settings such as word wrap, line numbering and auto...
 
htmlwriterswordeditorswordpadeditingconvertwritingprocessingnotepadwebprocessorstext editor

Freeware by PhaseOut team
82 x 2650Kb downloads

...Flash Designed Skin Web Browser with all the latest protection shields: Anti Phishing PopUp Killer and CleanUp tools with extended options, Integrated Advanced Search Tool Bar and Tabbed web windows...
 
popup blockerweb browserphaseoutskinscleanprivacycutomizationtabbed browserfreeware
XP TCP/IP Repair

Freeware by Waresoft Software
301 x 1842Kb downloads

Free Vista Files award
...XP and up that repair your TCP/IP registry settings and your Winsock LSP settings. Instead of having...to remember long confusing command line options you can now just click a button. What...
 
utilityrepairtcpoptimizerwinsockinternetwindowsguifreeware
Chomp

Freeware by Ossisoft
25 x 191Kb downloads

...just run the exe. There are different difficulty settings and you can set how long the computer...
 
rectanglebarchompblockpoisonsmallchunksquareeasysimplechocolate
Pong Solo

Freeware by Digital Liquid
39 x 5524Kb downloads

...from global to individual player settings.By using the options screen you can create a whole new game...
 
video gamepaddlepong gamegamesping pongsportspongsterarcadepong projectpong solo

Freeware by EleFun Multimedia
72 x 1144Kb downloads

...Multimedia Company, enables products’ navigation, setting up general options at discretion, download of the new products and...
 
desktop managerelefunanimatedwallpapersscreensaver
PDF SpeedUp

Freeware by AcroPDF Systems
44 x 589Kb downloads

...so the program starts quickly. It offers several options and you can also manually enable or disable...Adobe Reader Recent Files History Restore to original settings at any time Freeware!...
 
fastadobeslowstartupsettingsspeedreaderspeeduppdftweak
...ever before! There are a ton of configuration options to tweak the screensaver to your desire, including...more. You can also enhance the 3D glyph settings by adding a mirror reflection to them. You...
 
landscapecustomgreenglyphrevolutionsenterbackgroundscreensaverreloadedthe matrixrelax
...This utility will be handy for people who would like to leave their computer unattended for some time before automatically turning it off (logging off a user, rebooting it, sending...
 
logoffturn-offrebootnetwork inactivitycomputer inactivitycpu usagetimer shut-downstand-byhibernationtoff

Freeware by Personal
88 x 6835Kb downloads

...system is available at all the time Customizable settings and options are available and supports multiple users...
 
free downloadfreeware
Vista NetMail

Freeware by SoftwArea.com
41 x 1700Kb downloads

...to enter a new password and adjust the settings every time. Sort your mail by date, size,...fly without a need to restart the program. Options are also provided for standard e-mail clients: support...
 
mailingemail softwareemail clientlistmerge
IE Internet Security

Shareware by Ixis Ltd
33 x 1938Kb downloads

Free Vista Files award
...settings, restrict access to certain tabs of Internet Options dialog box, as well as specific settings from...
 
locksecurityaccesspasswordrestrictscreencontroladministratorprivacyfreeprotect
KATE

Freeware by Haptek Inc.
73 x 2870Kb downloads

...and background through an extensive set of preloaded options Includes automatic animations and moods for all favorite...
 
peoplecommunicatemorphputtychatavatarmessagesystemhapteksonorkcharactertextinstantspeechvirtualfriendsapi
ScreenSaver Druid

Freeware by XemiComputers Ltd.
52 x 1358Kb downloads

...provided by the program include bringing up screensaver settings dialog, previewing and deleting screensavers. You will also...set Wait parameter and enable password protection through options that mirror their counterparts in Control Panel. Double...
 
softwarecontrol centerscreensaversmanagerscreen saversmanagingxemicofreewarescreensaver druidxemicomputers