1 2 3 4 5 6 7 8 9 10 11 12 13

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
264 x 11118Kb downloads

...Network Monitor,Intern Firewall.Trace route,Shows release,Lists devices and network services,observing network release,observing all ports,direct access on all network releases in LAN,WAN and Internet....
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
ManageEngine Applications Manager

Freeware by ZOHO Corp.
91 x 49152Kb downloads

...Applications Manager offers a single integrated monitoring tool suitable for application monitoring, database monitoring, system...monitoring, website monitoring, services monitoring, and custom application monitoring. Applications Manager proactively...performance and availability data of the monitors. Application monitoring helps you achieve higher availability and optimized performance...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
ManageEngine OpManager

Freeeware by AdventNet Inc
115 x 39569Kb downloads

...tools! OpManager is a network and IT infrastructure monitoring solution that offers advanced fault and performance management...quickly installed and configured to start discovering and monitoring network devices in less than 60 minutes. -...SNMP, WMI and CLI. One can discover and monitor any new device purchased at a later date....from device status and health monitoring, OpManager also monitors VMware ESX servers, Applications, MS-SQL, MS-Exchange,...
 
network monitoring toolnetwork management softwareserver management software
...myProcMan is an interactive user friendly process manager for Windows. Detailed information provided about programs and processes running on the computer. Tool’s database contains more than 12000 processes and...
 
processesspywaremonitorsystemtask manager
EyeOnSite

Freeware by Virdi Software
31 x 824Kb downloads

...if they are accessible on the net. The services that can be monitored are http, ftp, smtp...status window shows the current state of all monitored services. Main Features: - Visual and audible alerts....interval when a service goes on error. - Services supported: http, ftp, smtp, pop3. - Pattern matching...
 
httpservicesite-watcherserverssite connectivity monitorsmtppop3ftp
Advanced Contact Manager Personal

Freeware by Xpress Software Inc.
45 x 5437Kb downloads

...calls, track the history of client contacts and monitor performance of everyone in the team.Advanced Contact Manager...main features: manages clients, categories, products & services and users; handles incoming and outgoing calls; keeps...
 
contactincoming callsoutgoing callscontact management
...MonX™ securely monitors some of the most important aspects of your...back-ups. Popup alerts - MonX will not only monitor the error logs (notifications) sent by your server,...saved and stored by users - MonX will monitor your server to notify you if you are...being installed or removed including automatic Microsoft Updates. Services - If Services are stopped, you will be...informed along with a definition of the services purpose.
 
freeeventlogsservermonitoringwindows
WMI Explorer

Freeware by KS-Soft
18 x 534Kb downloads

...a new management technology that allows software to monitor and control managed resources throughout the network. Such...
 
wmiwmi querywql
The Dude

Freeware by MikroTik
35 x 1836Kb downloads

...The Dude network monitor is a new application by MikroTik which can...draw and layout a map of your networks, monitor services of your devices and alert you in...
 
watchdogdudenetworksnmpnetwatchmikrotikpingmonitormanagement
System Safety Monitor Free Edition

Freeware by System Safety Limited
31 x 3216Kb downloads

...System Safety Monitor (SSM) is a Host Based Intrusion Prevention System...freeware. Working at the Windows Kernel level SSM monitors in real-time: * Malware and Rootkit Installation *...Driver Loading * Program Execution * NT Services Installation and State Change * Program State and...
 
monitortrojansafetyprotectionhackerintrusionadwarepreventionrootkitsecuritymalwaredetectionspyware
TCP Spy .NET Standard Edition

Freeware by Devolutions inc.
15 x 576Kb downloads

Free Vista Files award
...client and a server. Optimized for .NET Web Services or Web Site TCP Spy .NET will help...host. It`s a 4 in 1 tool: - monitoring tool - web service / web site profiling...server - Network / Web Site / Web Services spy Features: 1. General - Light (one file...user interface - Auto update - Free 2. Monitoring - Monitor connection IP address - Monitor connection...
 
httptcpsmart clientprofiler
Domain Name Commando

Shareware by CommandoWare, LLC
14 x 3846Kb downloads

...your domain names and web site(s) by regularly monitoring the whois registration records for expiration or unauthorized...pre-emptive action to protect your assets. Some web-based services charge $99/year per domain name for this feature...
 
domain namewhoismonitortop-level domainexpirationregistercctldregistrationexpireprotectdetaggedregistrar
Search Engine Commando

Shareware by CommandoWare, LLC
13 x 6949Kb downloads

...keyword and phrase important to your products and services for over 400 of the world`s top search...using the NEW DOMAIN NAME MONITOR, which regularly monitors WHOIS registration records for expirations or unauthorized changes....scheduling automatically runs the Reporting, Submission and Domain Monitoring functions daily, weekly or monthly, including ten attractive,...
 
rankdomain namepromotionmetasubmitwolfseosubmissioncompetitionpagesoptimizationplacementtagsdoorwaytraffictopdogcommandosearch enginelistedwhoismarketingwebpositionadvertiseurl
eXtended Task Manager

Shareware by Warecase Ltd.
12 x 11021Kb downloads

...Task Manager! eXtended Task Manager is a performance monitoring tool designed with the needs of developers in...
 
process managertask monitordll viewerwindows task managerprocess viewerperformance monitoringregistry analyzertask explorerregistry monitor
Twilight Utilities Phone and Web Server

Shareware by Twilight Utilities
28 x 3238Kb downloads

Free Vista Files award
...not enough, a utility is included to constantly monitor your homes internet address and if it changes...
 
telephonephoneservervoipwebservertelephonyvoicewinmodemgatewaytwilightutilitiespbx
EF System Monitor

Shareware by EFSoftware
17 x 901Kb downloads

Free Vista Files award
...What the EF System Monitor is and what you can do with it:...network. * When you run the EF System Monitor under Windows except the Windows 9x you can...use the advanced services provided by these Windows platforms, like process and...that suggest their functions. * The EF System Monitor can not only show you the data from...can do much more: With the EF System Monitor Server (included in the package) you can collect...
 
efsoftwareefsysmonmemorysystem monitorcpu
LinkAlertPC

Shareware by InBloom Products
8 x 4470Kb downloads

...The cost effective link monitor and alert notification system - LinkAlertPC (LAPC) can...Extensive event control includes Start, Stop and Resume monitoring of one or all links. A Test facility...
 
networkhttpsserviceftpfileemailmonitorlanibpfolderdiskinbloomtcplinkalertpcnotificationprinter

Shareware by IP Detective
14 x 4881Kb downloads

...*Set your Network Standards *Batch Ping *Manage Remote Services *Manage Remote Applications *Remote Shut-down and more...
 
networkaddressmonitor
FoldMonkey

Shareware by MonkeyJob Systems
11 x 2050Kb downloads

...backup your files and folders. Main features include: Monitor a folder for new or incoming files. Rename...FoldMonkey to run as a server service to monitor ftp folders or multiple separate services. All errors...
 
sortincomingmovefoldersfilecreaterenamedatedirectoriesmonitordirectoryfiles
NetWatcher

Shareware by Toleron Software
22 x 802Kb downloads

...and response time of the widely distributed network services (HTTP, SMTP, POP3, FTP etc.). Netwatcher was initially...in real-time operation mode as well as to monitor status of network services at application protocol level....
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping