1 2 3 4 5 6 7 8

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ManageEngine WiFi Manager

Freeware by AdventNet, Inc.
267 x 29328Kb downloads

Free Vista Files award
...Manager is a combined WLAN security and management software for 802.11 a/b/g networks. It presents a Web-based...
 
wireless securitywlan managementrogue access pointwireless lan managementwlan monitoringwireless intrusion detectionrogue detectionrogue blockingwireless network managementwlan network management
Finger

Freeware by Nsasoft US LLC
19 x 485Kb downloads

...Finger is the tool for discovering user information by using well known finger service. To use the finger tool enter the User@)Host in the Finger Input box, and click...
 
security softwarenet toolsfreewarenetwork utilsnetwork softwarefinger serviceinformation securitycomputer securityenterprise securitynetwork monitoringinternet securityport scannetwork toolnetwork securityhackingnetwork attack
...PhishGuard is a simple, FREE software service for computers running Microsoft operating systems (Windows 98...confidential information to the scammers. Within minutes, our monitoring team has verified the scam, and added it...
 
spoofingcreditcardfraudulentidentity theftscamsphishguardphishing scamaccountcredit card
...Stealth Web Page Recorder is a simple spy software utility for web page recording. This program will...
 
web page loggerinternet loggerinternet monitoringweb page recorderemail recorderinternet loggingemail spyspy mailstealthspy softwareinternet spymail loggerweb mailemail logger
...The user is able to see which hosts, services or ports were the top traffic consumers. MZL...traffic was made by a browser, a filesharing software or a secure connection. It contains an editor...- internet users are able to see, which services cause the most traffic - internet users are...can see bandwidth consumption cut by host and service of all machines in the local net MZL...
 
ethernetgatewaystatisticsinternetnetworktraffic analysisdslconnectionbandwidth usage statisticspacketscablebandwidth monitoringipdrvolumedata collectorreportonlinebroadbandtariff
SysAid IT Management Software

Freeware by SysAid Technologies
55 x 190713Kb downloads

...SysAid >Help Desk Software is a an all-in-one IT Help Desk software...gives IT admins one powerful and easy-to-use IT Service Management solution, in one place. SysAid includes standardized...Windows Phone 7. End users submit help desk service requests via SysAid`s intuitive End-User Portal, while the...priority, escalation, routing and notification rules (email, SMS, service requests). SysAid manages system vitals by automatically scanning,...
 
monitoringchatasset managementremote accessunlock accountmdmslaremote controlslmpassword resetbenchmarkitilbyodmobile device managementcmdbhelp desk
Host Evaluator

Freeware by Zed Seven Pty Ltd
12 x 383Kb downloads

...and make the move. With the Host Evaluator software you can add the web hosting plans you...who you are potentially going to buy hosting services from. Using Host Evaluators intuitive interface you can...host, you can still use the Host Evaluator software to continue to check your new server`s uptime...time! And the best thing is that the software is totally free!...
 
uptimeserveralertshostingwebsitemonitoringpingcompare
Web CEO Professional Suite

Shareware by Web CEO
31 x 30152Kb downloads

...Web CEO is a powerful professional software suite for site owners, webmasters, e-marketers and web...Manager, powerful site quality scanner and server uptime monitoring service. If you provide professional SEM / Consulting...
 
search engine submissionftp upload managerweb analytics toolkitwebsite auditseokeyword researchhtml editorlink buildingsearch engine optimizationlink exchangeweb promotionkeyword ranking checkersite uptime monitoring tool
TaskPatrol Personal

Freeware by Assembly Developers
16 x 2035Kb downloads

...TaskPatrol is able to identify and remove malicious software from your computer. These include, but are not...Other features available in Pro version include background monitoring to notify you when suspicious task is detected,...
 
malwarewindowsvirusadwareprivacynetworkprocesssystembhostartupsecuritytrojanservicebrowsertask patrolbackdoorspyware
ManageEngine SupportCenter Plus

Freeware by ZOHO Corp.
25 x 31744Kb downloads

...ManageEngine SupportCenter Plus is a 100% web-based Customer Service and Support Software that offers Trouble Ticketing, Account...Portal Reduce call volumes with a Web-based self service portal where customers can search the knowledge base,...support processes to deliver consistent, reliable and superior service to their customers. Knowledge Base Empower your Support...
 
contact managementrequest trackingcustomer support softwaretrouble ticketing systemworkflow managementknowledge basesla violation trackingself service portalservice level agreement
...PhishGuard is a simple, FREE software service for computers running Microsoft operating systems (Windows 98...confidential information to the scammers. Within minutes, our monitoring team has verified the scam, and added it...
 
scamsidentity theftphishing scamaccountfraudulentspoofingcreditcardcredit cardphishguard

Shareware by ADVSoft
16 x 4485Kb downloads

...English and Russian). The registered version of the software can also export reports to HTML, print reports...
 
wingatetrafficreportservermonitoringinternetauditlog
NetWatcher

Shareware by Toleron Software
22 x 802Kb downloads

...and response time of the widely distributed network services (HTTP, SMTP, POP3, FTP etc.). Netwatcher was initially...reinstallation or the application. In contrast to similar software products Netwatcher allows to track network transport layer...as well as to monitor status of network services at application protocol level. There is no doubt...
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping
AdRem NetCrunch

Shareware by AdRem Software, Inc.
13 x 94809Kb downloads

...NetCrunch offers agentless policy-based availability monitoring of Windows using WMI, Linux using SSH, NetWare...syslog servers. Program contains over 65 built-in Network Service monitors and user experience monitors for services like...
 
agentless monitoringnetwork management softwarenetwork services monitoringnetwork monitoring softwarenetwork mapping
Easy Network Service Monitor

Shareware by Javvin Company
13 x 2500Kb downloads

...Easy Service Monitor is a network fault management tool that...Web services: HTTP and HTTPs * FTP sites monitoring * Database Servers: Oracle, SQL, MySQL * Email...and IMAP4 * Telnet Server * Other TCP Services such as NNTP * UDP Services such as...Domain Name Service * Windows 2000/NT services * Monitoring of any network device with an IP address...
 
slanetwork monitornetwork managementfault managementnetwork applicationsservice level agreementnetwork troubleshootingservernetwork availabilitynetwork performance
XSpy Shield Gold

Shareware by Elcor Software
18 x 3647Kb downloads

...powerful and efficient anti-spyware solution, developed by Elcor Software company. It was carefully tested on several PCs,...then don`t waste your time and get the software here right now! The program scans the Windows...XSpy Monitor. This effective utility works in background monitoring running processes, cookies and browser settings. All tests...hijacks, blocks malicious ActiveX scripts and keeps malicious software out from altering the Windows registry.
 
dialerspluginskeyloggersvirusesbrowser hijackerstrojansnetwork managementadwaregeneric malwareremote adminstration toolswormsspyware
Live Chat and Website Monitoring

Shareware by Provide Support, LLC
12 x 16468Kb downloads

Free Vista Files award
...Provide Support is an online service that allows you to chat with your website...system supports 256-bit SSL encryption and features visitor monitoring with geographic location identification, IP address, referrer, visited...and Mac OS operator client. No plug-ins or software installation required on customer`s side. Fully customizable chat...
 
websitelivehelppush web pagescustomer service softwarelive customer supportweb sitelive help desk applicationlivechatvisitor monitoringlivesupporthelpdesklive assistancelive chat software
HDD Temperature Enterprise

Shareware by PalickSoft
6 x 5171Kb downloads

...HDD Temperature Enterprise is hard-drive temperature monitoring software for corporate networks and small businesses. This rather...
 
hdddriveadmincontrolpreventrecoverdiskmonitortemperaturenetworkdata lossoverheat
Chroniker for Availability Monitoring

Demo by NRG Global
12 x 24377Kb downloads

...FTP, Web servers, Mail servers, and Application servers monitoring TaskWatch monitors response time of your applications by...Predefined essential reports in real time: Top N, Service Level, Agreement (SLA) Daily / Monthly / Yearly...common attributes for easier management Profiles - Create monitoring window profiles e.g.: "business hours","weekends" Exclude maintenance /...
 
log managementcitrix monitoring softwarenetwork monitoringavailability monitoringsystem monitoringdatabase monitoringwebserver monitoringserver uptimebusiness dashboardsapplication response time
WebWatchBot Website Monitoring Software

Demo by ExclamationSoft
16 x 26217Kb downloads

Free Vista Files award
...it easy to implement website and web-based application monitoring for response time, downtime and error conditions. View...WebWatchBot 5.0 you can: * Quickly implement website monitoring for availability, response time, and error-free page loading...to shopping cart, check out) * Implement server monitoring and database monitoring to understand the impact of...powerful reports and charts showing your adherence to Service Level Agreements Within minutes,...
 
website monitoringserverweb site monitoring toolavailabilityexternal web site monitoringweb server monitoringweb site monitoring software