1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...or WebDAV folder. Active Directory synchronization provides easy integration with existing directory services. The included LDAPv3 server...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Free Download Manager

Freeware by FreeDownloadManager.ORG
1049 x 7039Kb downloads

Free Vista Files award
...files or whole web sites from any remote server via HTTP, HTTPS, FTP and BitTorrent up to...even more! The list of FDM features includes integration with the most popular browsers (Internet Explorer, Opera,...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...JScript, or PHP program. Give yourself total database integration for inbound email with PopMonger Gold. Mach5 PopMonger...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...application monitoring. Applications Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...Monitoring, Tomcat Monitoring, WebLogic Monitoring, WebLogic Integration Monitoring, WebSphere Monitoring, J2EE Web Transactions and Java...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
...Library can be used both on client and server side, with centralized management of all connections. Information...Library utilizes an elegant event-driven paradigm for easy integration into Windows applications. A special attention is paid...
 
securenetworkingencryptionprivate
...in real-time, while the operation is running. The server is able to perform remote file compression and...SDK utilizes an elegant event-driven paradigm for easy integration into Windows applications. A special attention is paid...
 
sharingprivatelibrariessecurefile

Freeware by Olvio IT, Inc.
28 x 513Kb downloads

...includes all the latest features, SIM and AIM integration methods, CC and ECHECK processing, hash validation, response...is able to connect to an internet time server and get the real time for a certain...
 
shopping cartcredit cardecheckauthorizenetpayment processing
TipicIM

Freeware by Tipic, Inc.
76 x 4324Kb downloads

...TipicIM can be used with the TIMP IM server or any XMPP/Jabber Compliant Server and is available...Interoperability with MSN, Yahoo!, AIM and ICQ - Integration with motime.com`s blogging community (register on http://www.motime.com )...
 
instant messagingtipicimjabber xmppvoipwebcamvoice callskype
FlexWizard - Site management via e-mail

Freeware by FlexWindow
24 x 569Kb downloads

...images by e-mail to the FlexWindow server. The server ensures that the content is placed on your...different users to different content. - Extremely simple integration into your web site. - No need for...
 
flexwindowupdatesyndicationserviceemailwebsitemanagementdemonstrationbasice-maileasyintegrateon-lineprofessionalonlinebusinesscontentcmsfreesimple

Freeware by IRCXpro
53 x 6662Kb downloads

...person. This new version allows full Windows Domain integration using NTLM and SSL Encryption support (for both...Client to Server and User to User) for businesses. It also...has Content Advisor integration to protect young users from the dangers of...
 
chattalkircdconferenceircxmirc
Fresh Download

Freeware by Freshdevices.com
112 x 2101Kb downloads

...your downloads by up to 400% - Easy integration into Internet Explorer, Netscape Communicator, Opera, and Mozilla...in both HTTP and FTP protocols. - Proxy Server support in both HTTP and FTP protocols. -...
 
download optimizerdownload managerdownload acceleratormp3internet optimizermusicspywareinternet boostmpgadszip

Freeware by Axmo Inc.
60 x 4501Kb downloads

...Many add-ons: fire transfer, sound effects, cool smilies, integration with IE (Internet Explorer) no spyware, fast downloads...
 
msnhostdomainserverenglishfriendssmssearchmulticastpicturesinstantaudiomessageyahoosharemultichatmulti chatmircmp3clientmessagingicqfree
IPsynchro

Freeware by IPsynchro
24 x 680Kb downloads

...WepPage / FTP file (uploaded to an FTP server through remote computer`s IPsynchro software) · unique integration...with Remote Desktop Connection · unique integration with pcAnywhere...
 
pcanywhereexternal addressreceive remote addressstatic addressremote desktop connectiondynamic addressipsynchro
LanWhoIs

Freeware by LanTricks.com
19 x 1038Kb downloads

...+ organizing custom query to any server; + integration with Internet Explorer; + Socks 4, 4a, 5...proxy servers support; + possibility of calling LanWhoIs from your...
 
whoisaddressdomain infoadvancedhostnameinformation
InternetFileSize

Freeware by Moveax, LLC
24 x 755Kb downloads

...real http or ftp link path. * Proxy server with authorization support: If your PC is located...on the proxy server or your file is located on authorization required...InternetFileSize inform you about authorization you need. Proxy server settings can be taken from the Internet Explorer....
 
ftplinkget sizeutilityhttpshell enhancementinternet file sizeexplorer
...agent acts as both a client and a server at the same time. Fine grained access control...to run search operation on the peers. The server module is able to perform file compression and...SDK utilizes an elegant event-driven paradigm for easy integration into Windows applications. A special attention is paid...
 
securepeer-to-peerprivate
Miraplacid Text Driver SDK

Freeware by Miraplacid
22 x 6680Kb downloads

Free Vista Files award
...Miraplacid Text Driver SDK generates virtual printer driver with all the functionality you find in Miraplacid Text Driver. You can customize it and embed into your software. With the driver...
 
text exportuploadftpsdkintegrationtext extractionvirtual printer driverdocument convertiontext importtext driver
dbForge Fusion for MySQL, Delphi Add-in

Commercial by Devart
11 x 9674Kb downloads

...Main advantages of dbForge Fusion for MySQL: - Integration with the most popular IDEs - Integration with...Visual Query Builder - Integrated Security Manager - Server maintenance toolkit - Schema export and import wizards...MySQL versions 3.23-6.0 - Direct access to a server dbForge Fusion for MySQL brings MySQL development and...
 
ide extensiondebuggerproject suppoborland delphi 2007database tooladd-inmysqldevelopmentstored programquery builderexportimportcodegearmanagementsql editorcode completion
dbForge Fusion for MySQL

Shareware by Devart
14 x 49931Kb downloads

...supports all MariaDB objects types. Key Features - Integration with Visual Studio 2010, 2012, 2013, 2015 -...- MySQL Connectivity: * Support of all MySQL server versions 3.23-5.x * Support of MariaDB * Secure...
 
database toolproject supportmariadbdevelopmentmysqldebuggerstored programcode completionquery builderide extensionmanagementadd-inexportimportsql editorvisual studio
Visendo Mail Checker Server 2006

Shareware by ppedv AG
26 x 10791Kb downloads

...With Visendo Mail Checker Server 2006 we present an e-mail solution for protecting...based on the very successful tool Mail Checker Server 1.3. SPAM detection and destruction is one of...the new main features. Mail Checker Server is located between the internet and your in-house...certain spam. In cooperation with the Spam Public Server of ppedv, rife spam mails soon are identified....use.
 
emailserver integrationanti spamvirusexchangeserver based