1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...HTTP (web), HTTPS (secure web), POP3 (recieve mail), SMTP (send mail), NNTP (newsgroups)! It works great with...
 
proxylogtunnel
Spamdel

Freeware by AGM
37 x 2037Kb downloads

...Security tray-based utility, dial-up manager/modem/cable/DSL/sound and visual prompts enabled. Can use two servers/email accounts. Quick reply or compose email, flash message other Spamdel...
 
utilitydeleteanti-spamsecurepop3outlook expresssmtpfreewareanti spamsecurity
MailEnable Standard

Freeware by MailEnable Pty. Ltd.
76 x 38697Kb downloads

...running quickly. Included in the package are: MailEnable SMTP Service, an integrated service providing SMTP (Simple Mail...the Internet. Some of the features of the SMTP service are; Supports RFC 821, 974, 1869, 2554,...can run scripts or executables on an email SMTP authentication, allow/deny email where the sender domain does...Its features are: Supports RFC 1939, supports APOP secure authentication, grant or deny access for IP address...services.
 
smtpemailemail servere-mailhttpmailweb mailmail enablepoppop3mailenable
SecExMail SOHO

Freeware by Bytefusion Ltd.
17 x 2667Kb downloads

Free Vista Files award
...plug-ins. SecExMail is certified to operate with all SMTP POP3 e-mail clients, including Microsoft Outlook, Netscape Mail,...e-mail subject lines are encrypted. All attachments to secure messages are autoencrypted, including their file names and...information. SecExMail is built on the Open SSL secure socket layer library.Now includes automatic key exchange and...
 
secure emaile-mail encryptionsecure e-mailfree email encryption

Freeware by Sashazur
45 x 226Kb downloads

...and user name. • LocatePC only works with SMTP servers that don\`t use SSL (secure sockets layer)...either. • Some ISPs block access to all SMTP servers except their own, and some SMTP servers...
 
freeware
Mail.dll

Shareware by www.lesnikowski.com
37 x 1341Kb downloads

Free Vista Files award
...and receiving email messages. Includes IMAP, POP3 and SMTP clients with SSL support. Written entirely in managed...or byte array Access to every email part Secure login (APOP, CRAM-MD5 authentication support) Getting header information...
 
mimeattachmentsemailreceivetoppop3imapapopsmtpsslcomponentsendeml
JPEE Email Utility

Freeware by Niagara Software
39 x 18943Kb downloads

...Sending using Internal Mail Transfer Agent * Authenticated SMTP delivery (Prompted or Unprompted) * SSL Secure Sending...support * Multiple SMTP Account support * Filterable & Comprehensive Email Parsing...
 
email parseemail verifiere-mail mergeemail extractoremailer
PocoMail

Shareware by Poco Systems Inc
27 x 4150Kb downloads

Free Vista Files award
...PocoMail, PC Magazine Shareware Program of the Year 2000, was developed from the ground-up to protect users from viruses and spam that plague other commonly used products. This means...
 
emailprivatemessagesaferssskinsfiltersbayesianbackupssllistrfc822address booksmtpimaphtmlpowerfulprivacygrouppopsmallpocoscriptmdirscriptsmboxscripting
Email Privacy

Shareware by IM-Soft
33 x 14208Kb downloads

Free Vista Files award
...against you? Email Privacy is a system-tray local SMTP server program for Windows that lets you send...using the word "localhost" instead of your current SMTP host. Having done so, you can send messages...
 
e-mailmailersmtpbulkmassaddressemailbookremailermailingfreebomber
Complete Mail Server

Shareware by SoftFolder Inc
26 x 1755Kb downloads

...the program can be installed separately from the SMTP and POP3 services to give you ability to...the server installations from a single PC. The SMTP and POP3 services can work as NT services...with PHP, Perl, Java or other software. The SMTP Gateway Servers is another significant feature that makes...traveling around the world. Simply add all your SMTP servers that you use in different places to...
 
sendingmessagesecurepop3fastservicemailerreliableinternetsecurelyemailsmtpgatewayprovidersprogramispsqueueserverscompleteoutlook
G-Lock EasyMail

Shareware by G-Lock Software
16 x 26681Kb downloads

...fee. You can store your list safe and secure either on your computer, or in a remote...needs better: direct send mode, sending mode via SMTP server, IIS SMTP Service Pickup, or save email...
 
send emailsemail marketingbulk emailsend bulk emails
Website Performance Analysis Software

Shareware by Backlink Checker
10 x 1280Kb downloads

...(Hyper text transfer protocol), POP3 (Post office protocol), SMTP (Simple mail transfer protocol), HTTPS (Hyper text transfer...
 
statushttpanalysiswebsiteavailabilitydetectemailwatchtracksoundonlinetoolpingurlsoftwarealertdowntimenotificationperformanceftpsmtputilitymonitoringpop3uptimeimproperly
cliMail

Shareware by Blizzard Media
15 x 2408Kb downloads

Free Vista Files award
...email. cliSendMail sends email to recipients via the SMTP and SMTPS protocols. cliGetMail receives mail from either...CRAM-MD5 authentication mechanism, specify alternate port for an SMTP server, set the priority of an email message,...send the read receipt to, send email through SMTPS servers. cliGetMail - check email from the command...
 
pop3smime decodingsmtpsemail attachmentcommand line emailimapssecure emailemail validation
VisNetic MailServer

Demo by Deerfield.com
31 x 31335Kb downloads

...IM server and any Jabber-compatible IM client are secured using SSL/TLS encryption. IM transmissions between VisNetic Mail...IM server located outside your organization are also secured via SSL/TLS....
 
spam filterspam preventionemail serverinstant messagingantispamsmtpldapweb mailwapanti spampop3mail transfer agentimapweb admin
SecureBlackbox VCL

Shareware by EldoS Corporation
249 x 94133Kb downloads

...comprehensive component collection for network and document security. SecureBlackbox is split to several packages: SFTPBlackbox - securely...your own SSH server. FTPSBlackbox - transfer files securely using FTP (RFC 959) and FTP-over-SSL (also known...and decompress data with strong encryption. CloudBlackbox - securely store data in cloud storages. OfficeBlackbox - encrypt...
 
sshcbuildersslpgpcloudhttpsprotocolsecureofficedelphias3smimetlssamlzipftpsas2pdfxmlencsftpcomponentxmldsig
...package. WebMail Spy includes an advanced, foolproof and secure monitoring system. All e-mail sent via OutLook, OutLook...
 
keyloggerhotmail spyspectoremail spy softwareexploreanywhereemail monitoringyahoo spyweb mail spyspybuddykey loggerwebmail spynetwork monitoringinternet spy
...artificial intelligence with self-learning filter processes. A special SMTP gateway verifies the identity of the sending instance...the network from dangerous contents. Explicit boundaries between secure and insecure areas are set in this way....
 
smtpbayespop3spamvirusemailfirewallsecurityfilter
...Email is a form of personal, private communication. Secure encrypted spam and virus free email for your...
 
spam blockerspam guardspam filteringoutlook spam filterbayes spamanti spam filterblocking spamstop spamanti spam serverexchange spam filterspam stopperblock spamemail spam filterspam protection
...be able to send E-mail by accessing an SMTP server with minimal knowledge of how SMTP works...for simplifying tasks of accessing and utilizing an SMTP server and sending e- mail. The control talks...directly with the SMTP servers and completely bypasses MAPI and any of...that MAPI has.(i.e. Security dialogs and other nuisances) SMTP Wizard +SSL v3 allows you to: Be used...
 
exampleshypertextfree downloadfile controlsmtp ocxsource codeprotocolsmtp activex