1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ForceVision

Freeware by Dmitry Malyshev
98 x 1640Kb downloads

Free Vista Files award
...ForceVision is an award-winning freeware bitmap image viewer with an attractive ease of use and...combines both a graphic files navigation and an image processing just fine. Scanning and printing possibilities will...modes of the viewer serve to properly improve. Image brightness, contrast, color adjustment, flip, rotate, resize, format...
 
bitmapjpgimage viewerimage converter
NeoPhoto

Freeware by DTLink Software
108 x 3973Kb downloads

Free Vista Files award
...Create an Instant Photo Website. Resize, rotate, crop and organize all of your digital photos into albums. Add captions. Email entire photo albums, automatically resized with captions included. Turning your...
 
publishredeye reductionphotoalbumcameradigitalweb pageorganizeresizepostthumbnailrotatescreen shotgalleryemailimage
ObjectDock

Freeware by Stardock Systems
439 x 12232Kb downloads

Free Vista Files award
...Newer features include Windows Vista compatibility, a new image searching feature, .DockZip support, a new algorithm for...drop support for items on docks, tabbed docks rotate automatically when docking them with a screen edge...
 
windowblindslauncherstardock
...Desktop wallpaper changer on steroids. WebtoWall grabs its images off of the Internet. You can add your...of web cams, radars and pictures. Plays animated images such as radar loops, has a customizable refresh...rate for image retrieval, will rotate between the selected images, has the ability to...display the current image in a separate sizeable window that can float...
 
wallpaperwebcamsscreen saverbackgroundradaractive desktop
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...Eye is a fast - and free - image viewer with a nice clean user interface. Feature...high-lights: - The only image viewer you need for viewing and browsing images....menus and toolbars wasting desktop space. - Uncompromising image quality. - Small and very fast, highly tuned...code. - Reads all common image file formats. - Image index feature with very...read finish. - Speculative decoding & caching of images in the background.
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Photomania Deluxe

Freeware by COSMOTEK
88 x 2033Kb downloads

...viewing, enhancing, and sharing your images. A full-featured image viewer quickly generates high-quality displays of your images....Photomania supports over 40 image file formats & 50 effects(filters). Image read support:...EPS, CUT, IFF, RSB, LBM, ADA, XPM, SCR Image write support: PNG, JPEG, JPEG2000, MNG, TIFF, BMP,...
 
adatiffpnggraphic skintgamngimage vieweralpha blendingxpmjpeg2000bmp32bit picturewmfemfgifrasimage enhancerphotomaniapcx
PictureNook

Shareware by Asygo
37 x 1581Kb downloads

...site Professional version allows to embed your own image watermarks in your photos or sign your photos...
 
digital photopictures albumphoto albumpublish imagesweb photo albumweb gallerypicture galleryweb photo galleryslideshowcreate web photo gallerywatermark
...This is a program that displays ambigrams. After you load an image, you can have the program animate the picture rotating 180 degrees. You can also flip pictures over a...
 
flipambigramrotateanimatedisplayshowview
Easy Thumbnails

Freeware by Fookes Software
178 x 1038Kb downloads

Free Vista Files award
...a handy freeware utility for creating accurate thumbnail images and scaled-down/up copies from a wide range of...interface makes it a snap to find your images and select them for processing individually, in groups,...folders, using a simple file selector and built-in image viewer. You can use slider controls to rotate...possible results. You can convert small batches of images inside Windows Explorer from the File menu or...
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your images...solution for anything from professional presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of...integrated MediaView component seamlessly allows you to view images in the right-click menu of the Microsoft Windows®...shell. For uncomplicated image viewing, PictureViewer .EXE provides a comprehensive slideshow utility...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Mihov Image Resizer

Freeware by Miha Psenica
52 x 363Kb downloads

...Mihov Image Resizer is a handy tool for batch resizing...You can make pictures or any kind of images smaller or bigger - whichever you need at...that you will only have to select the images and the program will do the rest for...them arround. What better way than with Mihov Image Resizer? You can rotate the photos to the...are too lazy to turn the pictures... Mihov Image Resizer is also a perfect utility for creating...
 
bigmihadigitalshrinkjpg2gifsmallcamerapsenicafitfreewareresizermihovrotatewinfilesbmp2gifsharewarepicturetransformgif2jpgimagebmp2jpgbatchconverterphotos
Image Converter .EXE 3 Scripting Edition

Freeware by SoftTech InterCorp
73 x 1502Kb downloads

...or using the built in graphical scripting interface, Image Converter .EXE 3 Scripting edition is a photo...professionals dream come true. A complete image editor, effects processor and photo converter all in...batch supporting scripting interface. Seamlessly convert thousands of images for your website, database or archive using the...software utilities or database modules. Whatever the need, Image Converter .EXE 3 Scripting Edition can help you...
 
photoconvertercommand linebatchmultiple fileseffectspictureconversionimage
Picture To Go

Freeware by Screaming Bee LLC
64 x 849Kb downloads

...tools make this program so convenient to use. Rotate your pictures with easy to use controls. Resize...
 
shareone-stepimagepictureemailfreemissingscreenshotphotopublishsearchfindresize
Pixel Editor

Shareware by Icon Empire
45 x 6511Kb downloads

...you`ll be able to create and edit small images in either standard, or custom sizes, in color...million colors, to create and edit semi-transparent PNG images in 32-bit color depth with 8-bit alpha channel...and shapes with antialiasing, rolling, shifting and rotating images will be as easy as ABC. Pixel Editor...files: .png, .bmp, .jpeg, .gif, .wbmp, etc. Resampling images with smooth, copying and pasting images to other...
 
glyphgraphiceditimageeditorpicture
Crawler 3D Earth Screensaver

Freeware by CRAWLER, LLC
134 x 9102Kb downloads

Free Vista Files award
...explore foreign countries, zoom in and out and rotate the globe. 3D Earth presents real Moon &...
 
earth mapplanet earthdesktop saverssatellite image earthsatellite picture earthearth satelliteearth viewerearth saverearth screensaverscreen savers
JPEG Lossless Rotator

Freeware by Anny
56 x 3837Kb downloads

Free Vista Files award
...handy tool for rotating digital photos and JPEG images without quality losses. In addition to preserving the...offers a neat and simple interface for viewing images and shell integration for quick mouse-click rotations. JPEG...computer users. Also features batch and automatic rotation, image flipping, renaming and deletion of files, digital photos...
 
photographyrotate2014jpgdigitalfreeannypicturequalityannystudiocalendarjpegflip2015rotationlosslessexifimagerotatorsoftwarefreeware
DrawPad Graphic Editor Free

Freeware by NCH Software
13 x 571Kb downloads

...and Create Graphic Images. DrawPad is an easy-to-use image composition and manipulation program, and an essential tool...pencil and brush tools, raster and vector images, image layers for non-destructive editing, and effects such as...and painting *Work with both raster and vector images *Image layers allow for non-destructive editing *Add effects...
 
drawingeditcreategraphicsgraphic image editorpaintdrawing softwareimagesgraphic editorfreeeditingsketchpaintingsketchingdesign
PaintStar

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...Transformation tools including rotate,scale,shear,perspective,flip,and wrap. Auto antialias supported. Image Morphing supported. With this technique, you can create...sequence of intermediate frames that seamlessly transform one image to another and generate output in a form...of gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and...area to be captured.
 
freewaremorphlayerpathscreen captureimage editor
Paint.NET

Freeware by Rick Brewster
43 x 1600Kb downloads

...learnable without assistance. In order to handle multiple images easily, Paint.NET uses a tabbed document interface. The...tabs display a live thumbnail of the image instead of a text description. This makes navigation...software, layers form the basis for a rich image composition experience. You may think of them as...curves, and levels. You can also convert an image to black and white, or sepia-toned. Powerful Tools...
 
paintphoto editing softwareimage editing softwarephotoshoppaintnetpaint softwaregimp
Digital Image Tool

Freeware by Bruce McArthur
62 x 5201Kb downloads

...Batch process images quickly, applying flexible resizing methods, rotation, cropping, scaling,...watermarking, renaming, tagging and more. Batch Image Resize Either scale or apply max width or...height settings, images are never scewed or scaled over 100% Batch...apply a particular rotation to all images. Batch Image Watermark Use built in or custom watermark using...include their own transparency for best results.
 
imagebatchbatch image tooldigitalfreebatch image resizescalephotodigital image toolrenamelogowatermarkrotatecropwatermark imagetag