1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
264 x 11118Kb downloads

...all computers and networks.This area analyses the available resources like printers or global PDF-services on the scanned...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Mimosa Scheduling Software Freeware

Freeware by Mimosa Software Ltd.
171 x 977Kb downloads

Free Vista Files award
...shift plans, training programmes, festivals and many other resource bound events in a wide range of business...It has a rich set of efficient optimization tools and you can move data easily to and...scheduling domain since you can define the needed resource types and calendar schema according to your own...weekly patterns for over 8000 different courses and resources (teachers, classrooms, equipment, etc.) in a single small...
 
schoolscheduletimetablesoftwareuniversity
Free Vista Files award
...types of documents including program files, project files, resource files, HTML documents, MS-Office documents, pictures and drawings....
 
version controlcvs clientrevision control systemworkflow managementinexpensive case toolprogramming toolssource change controlprogram problem tracking
...novice user. With CS-CVS, the complicated setup and resource demanding maintenance of classical CVS clients is virtually...
 
program problem trackingversion controlinexpensive case toolcvs clientrevision control systemsource change controlprogramming toolsworkflow management
Picture Viewer .EXE

Shareware by SoftTech InterCorp
52 x 2377Kb downloads

...PictureViewer .EXE provides access to powerful image management tools that make it an unparalleled resource for your...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
...pageQ is a new browser, web playlist maker and search engine combined. Like iTunes for web pages. Use pageQ as your browser while searching the web. Capture the pages you...
 
web researchsearch engineweb page playerweb presentationbrowser toolsbookmark managerfreeware
Keepoint 7

Freeware by Saora Inc.
13 x 6308Kb downloads

...turbocharges Internet research, making internet a truly rich resource that it was envisioned to be. FEATURES: *...
 
saorabeyond search enginesinternet explorer addonweb research softwareannotatekeepoint prooffline browseradvancedweb information manageroffline browsing toolsoffline web browsingweb research engine
...Topicexplorer is a weblink and file manager that also includes intelligent keyword search. plus free web link content (business, home, education, travel sport and entertainment) Topicexplorer offers a unique heirarchy...
 
link managerbrowser toolsweb browsertopicsbookmark managerplugins
FreeSysInfo

Freeware by Nsasoft US LLC
13 x 554Kb downloads

...status, user and system accounts, proxy settings, shared resource information and more. The tool is designed with...
 
roguehacking resourcessysteminformationadapterfreewarenetwork scannerhacker toolsnetwork utilnetwork toolserveraddressinternet scannernet toolsnetwork softwarediscoveryfree downloadwmisecurity scanneranti hackerndis
Swiftpro CVPlus Visual Recruitment Software

Shareware by Swiftpro Ltd
11 x 32595Kb downloads

...the screen. Powerful, practical, time and contact management tools enable fast, efficient communications with clients and candidates...
 
hiringpersonnalsoftwareresourcerecruitmentmanagement
27 Tools-in-1 Wichio Browser

Shareware by Revopoint Co., Ltd.
13 x 6685Kb downloads

...Wichio is a tabbed browser with 27 built-in utilities. It`s easy to use: to set options for any utility, just right-click its button. If you install the...
 
reminderflashtranslateprivatehistorye-mailresourcelyricnetstatdictionarycookiesscreenupdatespeechfillerrefreshtraceroutewhoismapdnsvoicecurrencycacheblockalertcaptureweather
PC Atomic Sync

Shareware by Brigsoft
32 x 789Kb downloads

Free Vista Files award
...the program is idle and is not wasting resources of your PC. Synchronization is done automatically while...do anything, mostly the program is not wasting resources of your PC but your PC clock always...
 
utilitiesprogramsinternetatomiclocalwindowssntpsynchronicnistsynchronizeutilitydailysynchronizationclocktools
Site Statistics

Shareware by NetPromoter
19 x 15392Kb downloads

...a professional Web analytics solution for analyzing Web resource activity. Statistics analysis is a vital part of...of both and provides a set of additional tools for Web site optimization. The software is designed...
 
site promotionwebsite counterstatistics analysissite statisticssite optimizationlog analyzer
WEBSmith

Demo by Soft Idiom
13 x 10254Kb downloads

...from, WEBSmith 3 includes a wealth of essential tools needed to create an engaging, interactive website. Implement...eCommerce, content management, news management, resource booking, visitor specific content, timed content, events, mailing...the website content, products, navigation, articles, news, events, resources and vacancies, through a simple to use browser...
 
website developmentinteractivemailingcontent managementstorememberssellecommercecodingcomponentsdynamicwebsmitheventseasyprogrammingbookingshopping cartrenovatewebsite authoringupdatenon-technicalnews
Appointment Book

Commercial by Appointment Book
32 x 18300Kb downloads

...so that you can manage your employees / resources days on and off and holidays too. Additionally...Book will reassign appointments to another employee / resource of your choice! Video, Sound and Voice reminders...and even assign one or more employees / resources to one or more customers or vice-versa ....
 
timetableappointments bookelectronic calendarschedulingtimesheetsoftwareschedulebookingsmyobquickbooks
...Strip Comments Highlight Source Enhanced Workspace Manager: ClassViewer Resource Editor Integrated Tags Language Intelligence: IntelliTips QuickTips Function...UltraEdit-32 Toolbar Build Toolbar HTML Toolbar IntelliTips Toolbar Resource Editor Toolbar Tools Toolbar much more... See http://www.ultraedit.com/produ...
 
programmers editorhex editorphpuestudiotext editorbinarymacspell checkersyntax highlightinghtmlunixdevelopment environment
Free Vista Files award
...powerful Bible software that provides users with many tools to enhance Bible study, with an intuitive interface...show you every book, commentary, topical, or dictionary resource that references the verse or passage. SwordSearcher`s Bible...SwordSearcher is tightly integrated so that navigating between resources and verses is seamless. SwordSearcher`s library includes over...
 
religionconcordancestudykjvbible softwarechristian
Antechinus Animator Professional

Shareware by C Point Pty Ltd
31 x 13736Kb downloads

Free Vista Files award
...images by further 40-65% with the best compression tools available. The preview lets you see how the...web pages, or applications with advanced screen and resource capturing. Capture anything of any shape you see...
 
avi softwaresoftware for animationdownload animation softwarempg2avicomputer animation softwareavi2mpegvideo capture screenmpeg2avigif animation softwarescreen capture software
Logo Design Studio

Demo by Summitsoft Corporation
10 x 39401Kb downloads

...symbol, icon or trademark using the flexible design tools of Logo Design Studio to quickly produce thousands...add to your logo; 5) Slogan and tagline resource library; 6) Accurately match any website background using...Design Studio offers the greatest range of designer tools to help you quickly and easily create a...
 
design logologo shoplogo design studiologo creationlogo design softwarelogo makerlogo softwarelogo designerlogo creator
ALO RM to MP3 Converter

Shareware by alo software
58 x 6915Kb downloads

...RM to MP3 Converter is a professional conversion tools for converting RM, RA, RAM, RMVB, RMJ, WAV,...
 
ramaudio convertermp3wavaiffwmaoggrmjmp2vox