1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
294 x 11118Kb downloads

...New Modul, System information, Hard and Software Inventary,Decoding Files . The network scanner uses IP-addresses, IP-Ranges, and...all computers and networks.This area analyses the available resources like printers or global PDF-services on the scanned...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
...Reader - Free reader / Viewer to read files created by Smartworks Project planner version 4.0 as...well as MS-Project MPP files . Frees you from having a project management...of gantt charts , Network diagrams, cost , resource and estimate graphs. However the user cannot modify...print it. The Reader can read the PPR files exported by all editions of Smartworks - Project...
 
primaveraproject plannersmartworksviewerms-projectreader
Mimosa Scheduling Software Freeware

Freeware by Mimosa Software Ltd.
189 x 1360Kb downloads

Free Vista Files award
...shift plans, training programmes, festivals and many other resource bound events in a wide range of business...scheduling domain since you can define the needed resource types and calendar schema according to your own...over 8000 events (courses, exams, meetigs etc.) and resources (teachers, classrooms, equipment, etc.) in a single small...you to create up to 80 events and resources (courses and components). Mimosa is built for Windows...
 
schedulesoftwareschooltimetableuniversity
EfreeBuy Folder Icon

Freeware by EFREEBUY
239 x 686Kb downloads

...can extract an icon from any type of resource files like .exe files.Aren`t you bored with the way...
 
folder iconfolercustomize icon
EControl Syntax Editor

Freeware by EControl Ltd.
92 x 952Kb downloads

...type of text file. Lexer uses standard VCL resource streaming and stores itself in DFM text format....Delphi 2007 like editor; - Fast loading huge files (several megabytes). - Localized: English, Russian, German; -...
 
aspspell checkingeditfoldinganalysishighlightingsyntaxhtmlxmlformateditorcontrolplain textkeymappingcode editorphplexer
Backup Deluxe 2005 SE

Shareware by FlexibleSoft Co.
55 x 4423Kb downloads

...you can designate certain share of your system resources to it. Several backup types allow still better...shadow copy of your data and replicates selected files including those used by your system. You can...data you need. The size of your backup files depends only on your settings, since the program...
 
filedatadvdsystembackuptaperestoresoftware
Free Vista Files award
...the ideal solution for sites that share common files on UNIX and Windows platforms. CS-RCS handles all...types of documents including program files, project files, resource files, HTML documents, MS-Office documents, pictures and drawings....
 
version controlcvs clientrevision control systemworkflow managementinexpensive case toolprogramming toolssource change controlprogram problem tracking
System Tracker

Freeware by AuditMySoftware.com
37 x 290Kb downloads

...click on any process. Basically it describes the files you may have found and explains what they...machine, regardless of location. See our online help files for a complete set of options available for...each tab. You will find the tabs resourceful and intuitively simple to use. Other utilities are...charge. Whether using it to track down system resource traps that create performance anomalies, or just to...
 
utilityviewauditsoftware
Mp3 Speed Accelerator

Shareware by Dextronet
25 x 2407Kb downloads

...Accelerator enables you to speed up your audio files - mp3 files, ogg files and other formats....It can also rip audio track from video files and speed them up. Did you know that...Speed Accelerator can also slow down your audio files for various purposes. Mp3 Speed Accelerator is very...really helps to save time, the most important resource of today`s world. - Change speed of MP3...
 
faster wmachange mp3 speedmp3 acceleratorplay mp3 fastermp3 speed changerslow down mp3wma speedrip audio from videofaster oggfaster mp3accelerate mp3ogg speed

Freeware by ComponentSpot
26 x 862Kb downloads

...multiple attachments. • Connection retry count. • Sending files using MIME encoding. • Synchronized, thread-safe wrapper. •...
 
smtppop3assemblyemailimap4aspnetvbnet
nnCron LITE

Freeware by nnSoft
38 x 241Kb downloads

...(Unix) and is managed with easy-to-edit text crontab files that are fully compatible with Unix crontabs, -...answer your current needs, - it is not resource demanding and it can run even on very...
 
servicelaunchfreesystem command schedulercron for windowsforth language
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...resize, print, delete, copy and rename your image files quickly and efficiently. Use the file information editor...image management tools that make it an unparalleled resource for your imaging needs....
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
EasyWare B2B Commerce

Freeware by EasyWare UK Ltd
29 x 17707Kb downloads

...sites should use EasyWare Shopping Cart instead. Minimal resource demands: EasyWare requires only that the host computer...
 
online storestore buildere-commerceecommerce
EasyWare Shopping Cart

Freeware by EasyWare UK Ltd
28 x 19860Kb downloads

...Scratch should use EasyWare B2B Commerce, instead. Minimal resource demands: EasyWare requires only that the host computer...
 
ecommerceonline storee-commercestore builder
MacExplorer

Freeware by Soft Experience
19 x 2573Kb downloads

...PC explorer analyzing Mac files on Windows servers for a quick access. Display...(Signatures). Windows users will identify the kind of files without their 3 characters extensions. List sizes of...data and resource fork. Displays the size of data forks and...codes (Signatures) Displays the Macintosh type of the files (XPress, Photoshop, Word, etc.), allowing to a Windows...
 
forkscatalogsoftwarepropertieswindowsfile managementpc-macpropertyfreeqxdextensionsdocumentdisplay typecreatorsfmsearchexplorermacintoshmac-pctoolmac2pc
RMChart

Freeware by Rainer Morgen
117 x 1336Kb downloads

...chart, store it in your application or a resource file and "play back" your static charts with...print your charts or save them as *.jpg/*.png files from within your applications....
 
chart designerpie chartsbar chartschartingline chartsscatter charts
Office Diary 2006

Shareware by NewEasy Technology
22 x 1193Kb downloads

...interface just like Office Word 2003. 2.Low system resource requirements. 3.High reliability file structure and storage engine....
 
documentdiarynotes
ResGrabber

Freeware by Sergei V. Lepitko
26 x 212Kb downloads

...Extract resources from .NET assembly or Windows executable module and....NET resource files and save them in native format...
 
applicationdeveloper toolassemblyresources
...Officer is an autonomous provider of log-on and resource restriction security application integrated with, yet independent of,...feature "Folders Guard" can help you keep your files protected. You can choose who gets access to...what files on your computer. This program provides two levels...
 
folderfilesecuritypasswordaccesslocksecuringcontrolprotectadministrationinternetwindowsguardprivacy
Resource Tuner Console

Shareware by Heaventools Software
30 x 3023Kb downloads

Free Vista Files award
...enables developers to automate batch editing of the resources embedded in 32 and 64-bit Windows executable files....This command-line resource editor allows using VBScript to create a repeatable...version information on existing Windows EXE or DLL files without needing to recompile the source code. The...editing and repetitive tasks. All the functionality of Resource Tuner Console is called from within your script....
 
batchexeversiondllscriptfileresourcecommandlineeditoricon