1 2 3 4 5 6 7 8 9 ... 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Advanced Youtube Dailymotion FLV Video Gallery (XML)

Shareware by FlashComponents
16 x 488Kb downloads

...with other functions: text playlist and a new random function. The video gallery can be edited from...
 
actionscriptflash components
...12 full sized and 28 mini images in random order, includes a short version of the CD...
 
calfmoosemckinleycalvesanimalsalaskawildlife babiesnaturedenaliscreensaversbaby animalsscreen savers
Advanced Tetric

Freeware by MyPlayCity.com
157 x 1927Kb downloads

...involves variations of 4 blocks, this version uses random variations of 2, 3 or 4 blocks. Advanced...
 
familysharewarecomputer gamearcadelogic gamefree tetrisplay tetrisfreewaretetris downloadpuzzleeducation
Egg

Shareware by Sinner Computing
13 x 64Kb downloads

Free Vista Files award
...screen alarm, auto hide buttons, customisable menus, and random alarm times. Egg can also be minimized to...
 
mp3trayhttpcountdownsinnerworkalarmreminderquadfull-screentimerrestchessremoteassemblyclock
PDF Combiner

Shareware by I Tech
32 x 1424Kb downloads

...Pdf Combiner software automates the process of concatenate, append and split pdf files, you can append to a new pdf file, an existing pdf file or append a list of...
 
portable document formatsinglereduce work flowpdffilespoolutilitypapersolutionmultipleeasyrandomuser friendlyinteractivecombinermergersplittersaperateconvertortool
Leawo Video Converter

Shareware by Leawo Software
17 x 35768Kb downloads

...Leawo Video Converter is a powerful video converter that can easily convert common and DRM-protected video files between all popular video formats and into popular audio formats with excellent...
 
video flv converteravi video converteravi mpegwmv video convertermp4 video convertermp4 wmvvideo avi converteravi mp4avi flvvideo ipodvideo dvdmpeg video converter
SpamSit

Shareware by Kykas Corporation
1 x 29315Kb downloads

...choose to protest scam spam by responding with randomly generated email. Unlike a spam filter, SpamSit is...the host and hold the connection for a random amount of time. Because web hosts can only...to protest this spam you can send a randomly generated email response. If the scammers receive too...
 
spamspam protestend spamdirect actionanti-spamcyber sit-inprotest toolantispamoccupy spam
...first time you use the program. - A random number generator so that every worksheet is different....
 
worksheetdivisionmathematicsadditionteachersubtractionmultiplicationtool
Fantastic Flame Screensaver

Shareware by Laconic Software
19 x 4927Kb downloads

...70 in total!). Finally, Fantastic Flame has the Random Flame Style - you`ll never get tired of...
 
burning biohazardcatch firegame posterscrackling soundssmoke effectfantastic flame screensaverfire soundschimespopping soundszodiac signs
MEDIA Revolution

Freeware by IN MEDIA KG
275 x 39339Kb downloads

Free Vista Files award
...after last Title/actual Title -"Sidebar" - Playlist -intelligent Random function -Bookmarks -WakeUp with your PC! -Zoom Function...
 
digital video recordershutdown playerhiberrekorderaudioplayerdivx playermediaplayertimed hibernateavplayersidebartimed shutdownplaylist sidebarnetsendaviplayervxiddvd playertabletpc compatiblevideoplayer
Keeping Your Secrets Secret: SDS

Freeware by Seecrets.Biz
15 x 2986Kb downloads

...cryptography and AES 256-bits. All symmetric encryption uses random numbers as keys and our own Seecrets Signature-Free...world`s first with the strength (entropy) of a randomly generated 256-bit AES key. It is also resistant...
 
rsasecretscertified deliverycryptopassword managersecure emailfor-your-eyes-onlyaesseecretsencryptionsecure delivery
The JukeBoxer

Shareware by The JukeBox`er
33 x 30320Kb downloads

...The main features are: Jukebox functionality (queue and random play ) MP3, WMA, OGG, Wav, Flac, Aac,...
 
mp3karaokejukeboxtouchscreencdgradioplayerweddingnew yearplaylistripperchristmasvideo
Merge Pdf Files

Shareware by I Technologies
23 x 1424Kb downloads

...merge pdf file software automates the process of cocombining, append and split pdf files, you can append to a new pdf file, an existing pdf file or append a list...
 
utilitymergerportable document formatmultiplepoolrandomfilespdfsolutioncombineinteractivereduce work flowsoftwaresinglesplitterconvertoruser friendlyeasysaperatepapertool
PDF Integration

Shareware by I Tech
1 x 1424Kb downloads

...Pdf Intergation Software automates the process of integrate, append and split pdf files, you can integrate to a new pdf file, an existing pdf file or append a list of...
 
mergersingleuser friendlyutilitytoolpoolpdfconvertorcombinereasysaperaterandomportable document formatpapermultiplesplitterreduce work flowfilessolutioninteractive
...12 full sized and 28 mini images in random order, includes a short version of the CD...
 
cubsdenali national parkscreensavernaturepuppiesmckinleyscreensaversalaskascreen saverspupswolvesbaby animalswildlife babieswolf
Pictoscope

Freeware by Bruno Cancellieri
6 x 2236Kb downloads

...even set the image in a slow and random motion. The cropped or resized image can be...
 
picturesviewerimagephotographimage viewer
MailEnable Standard

Freeware by MailEnable Pty. Ltd.
67 x 34838Kb downloads

...MailEnable Standard Edition provides SMTP, POP3 and webmail services for Windows Server 2003/2008/2013 Server systems. Its simple installation procedure and powerful administration software means that you will be...
 
popmailenablemail enablemail serverhttpmailpop3email servere-mailsmtpweb mail
Shell Whirl

Demo by BeachWare
14 x 15120Kb downloads

...Adventure." You start with a game board of randomly spinning shells. It is your goal to spin...but there is no map progression and more random game boards. Play whatever game the tide washes...
 
gamepuzzlebeachwarecasualwhirlspinmatchshell
Aiseesoft WMV to DVD Converter

Shareware by Aiseesoft Studio
1 x 36556Kb downloads

...Aiseesoft WMV to DVD Converter is the professional WMV to DVD converting software which aims to help you burn WMV, ASF, VOB, RM, RMVB video to DVD disc, DVD folder...
 
wmvconvert wmv dvdwmv dvd converterburn wmv dvd
PDF Merger Splitter

Shareware by PDF Merger Splitter
36 x 1424Kb downloads

...PDF Merger Splitter is utility software developed for merging various different pdf files into single file containing the information & data from all files in the sequence you have merged them....
 
saperateuser friendlysplitterconvertorsinglefilesmergerfusemultiplesolutioninteractiveeasypaperpdfrandomportable document formatcombinereduce work flowutility