1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...The included web client integrates e-mail, RSS feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar),...supports LDAP over SSL (LDAPS). Support for standard public key encryption and signing of e-mail encapsulated in...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
EScrambler - Webmaster Antispam Utility

Freeware by InnerPeace.Org
22 x 9Kb downloads

...email from your web site? Provide your email addresses to legitimate visitors of your web site without...only one purpose -- to add your email addresses their spam lists. EScrambler makes your email addresses...invisible to spam crawlers. EScrambler hides your email addresses in plain sight. Visitors to your web pages...can read and click on your email addresses the same way they do now. Human visitors...indexing your site.
 
anti spamtoolkitscramblerwebmasterinnerpeaceemailaddressfighterjavascriptescramblerhtmlblocker
...unavailability. Each Hamachi client is assigned an IP address from the 5.0.0.0/8 address block. This address is...time, and is henceforth associated with the client`s public crypto key. As long as the client retains...Specifically - 10.0.0.0/8, 172.16.0.0/12 and 192.168.0.0/16. The 5.0.0.0/8 address block is reserved by IANA and is not...be able to connect to any Internet IP addresses within the range as long as the Hamachi...
 
vpnmulticastudpvirtual private network
Free Vista Files award
...while traveling? Need to have your letters and address book with you, but don`t want to carry...and prior email correspondence, as well as your address book. Many email services have access to free...flash memory stick, allowing you to store your address book and any important correspondence you might need...and have immediate access to your email and address book with no installation required. Reach-a-Mail is a...
 
usb based portable emailportable email clientreach-a-mail
FTP Master

Freeware by FTP Master
30 x 2258Kb downloads

...server anywhere on the Internet. Whether you`re making public a Web page; downloading the latest digital images,...in that you give FTP Master a remote address to connect to after which it creates a...
 
uploadwindowsinternetprotocolfilestransferconnectionftp
ViPNet OFFICE

Shareware by INFOTECS GmbH
31 x 63335Kb downloads

Free Vista Files award
...to create a private network deployed in a public domain nevertheless absolute privacy, security, and manageability to...other features. ViPNet supports NAT-Traversal for passing Network Address Translation devices, Cisco SCCP and SIP protocol for...
 
firewallencryptionvpnvpn softwareinternet securityvpn clientpersonal firewallvpn servervpn gateway
Dynamic IP Update Service

Shareware by Fleisoft
68 x 549Kb downloads

...your ISP, you are assigned a temporary IP address that other computers use to find you while...you are connected. Once you disconnect, that IP address is given to someone else, and so on....you, they need to know what your IP address is. This is not easy if your IP...to keep telling everyone what your current IP address is (comparable to changing your phone number every...and only tell the service what your IP address is. This way everyone will be able to...
 
publicdyndnsdynamic addressdynamische adressedynamic dns serviceexternaldynamische dns dienstedtdnswindows service
Foxy

Shareware by 2 power n
22 x 1000Kb downloads

...filters and external user-written scripts. * Hides IP address and browser/OS information by spoofing sensitive HTTP request...other header). * Allows to surf anonymously using public proxies. Any number of proxies can be used;...
 
content filtering proxyscriptbannerstraffic reportsblocks popupscookiesdictionaryparental control

Freeware by Event Sound UK
10 x 119Kb downloads

...are looking for a wedding dj, mobile discos, public address system, microphone hire, projector hire, disco equipment, light...
 
discosprojecoterhiremobileweddingsbedfordshirelutondjssound systems
Internet Connection Counter

Shareware by CountersLab
25 x 909Kb downloads

...of remote address. Synchronization of system time with public NTP servers of exact time in the Internet....
 
isplanftpadsl connectioninternetmoney expensesstatisticscounter the trafficgraphs speedgprsdial-up
TrafMeter

Shareware by LastBit Software
20 x 4257Kb downloads

...the traffic by any condition (for example, IP address of source/destination, protocol, port and etc) in real-time...other reports. TrafMeter has own built-in NAT (network address translation) engine which enables multiple hosts on a...network to access the Internet using a single public IP address. The firewall (also built-in TrafMeter) defends...traffic accounting in networks with dynamic allocated IP addresses and the problem with IP/MAC address...
 
countertraffictraficshaperreportsrealtimemonitoringnetworkxmlaccounting
WinWebMail Server

Shareware by WinWebMail
37 x 8620Kb downloads

...4. Powerful three-tier infrastructure for personal and group address book management, including personal contact lists, domain public...contact lists and public (system) contact lists, and complete administration features as...
 
imap4serverantispamwebmails-mimersabbssmtpantivirusssldsspop3mail server
Pivo SSH Component

Shareware by Pivo Corporation
20 x 810Kb downloads

...SSH supports various authentication schemes such as password-based, public key or keyboard-interactive, allowing the client authorize itself...
 
commandemail addressasp net componentpop3smtppingsshemail parserasp componentserver component
GroupMAN

Demo by TNL Total Solutions
18 x 6777Kb downloads

...-Allow subscribers to have DIGEST ONLY subscriptions -Create public or private lists. -Create reminders for project management...
 
majordomolistservemaillist serverdiscussion list
...its ability to personalize your communications. You can address everyone on your list by their first name,...
 
mailemailexpressmailing listpostmaillistbulkmergepersonalizesendsoftware
Your Camera

Shareware by Twoja Kamera
42 x 3402Kb downloads

...Your Camera - remote video supervision system for home and firm. Simple to install and user friendly. Remote access from: PC computer, mobile phone, Palm/PocketPC. Detection of motion. MPEG-4...
 
web servercctvmobile phonecellphonesupervisionsurveillancedvrwebcammonitoringweb cameravideo server
Office Organizer

Shareware by Softaccord Group
23 x 1644Kb downloads

...mail server, real-time communication channels for users (chat), public (for users groups) network organizer, or personal organizer...and creation new tables (database program includes: note-book, address book and URL organizer), database explorer....
 
networkchataddress bookdatabaseorganizeradjustablemailclient
ShareO for Outlook

Shareware by 4Team Corporation
17 x 8106Kb downloads

Free Vista Files award
...journal items without Exchange server. Share Microsoft Outlook Public or Personal folders, Windows documents and files with...calendar, share Outlook contacts, sync Outlook contacts and address book automatically or manually. Secure Outlook sharing and...management and privacy filters. Create, share and synchronize Public folders without Exchange server. Work online or offline:...
 
share contactssync outlooksharing outlookshare outlook contactssharing emailsharing pstoutlook syncshare outlook calendarsharing outlook calendarshare calendaroutlook sharingoutlook sharesynchronize outlook
POPcon PRO

Shareware by Servolutions Inc.
24 x 5487Kb downloads

...mailboxes to multiple MS Exchange(TM) users according to address the mail was sent to. * Scans incomming...Emails for SPAM against public internet spam blacklists and reroutes or deletes spam...
 
connectorimapemailpop3 exchangedistributeexchange serverexchange pop3
Add Contacts

Shareware by MAPILab Ltd.
20 x 4564Kb downloads

Free Vista Files award
...Add Contacts automatically adds e-mail addresses to the contacts folder when you reply to...new message. This will help you avoid losing addresses of people you correspond with. Moreover, the collected...Wizard to have messages from certain senders (whose addresses are in the address book) placed in a...to detect the name corresponding to the e-mail address automatically. So, if you have received a message...from the address "John Smith" [smith@mail.
 
outlook add-inaddonauto remember addressesoutlook softwareadd contactspluginaddinmsoutlook