1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...Biology look at the most intrigue molecules - Proteins and DNA, if you have a rest. Any...sight) can see 3D Stereo image of complex proteins on a full screen, using simple and the...use Screen Saver VisProtSSS to look at the Proteins and DNA in stereo for the scientific goals,...
 
protein visualizationprotein structurepdb vizualizerprotein vizualizerscienceprotein viewerscreensaverpdb visualizationstereovisualizatoranaglyphpdb viewerscreen savermolecule
Advanced Pathway Painter

Freeware by GSA
30 x 5145Kb downloads

Free Vista Files award
...any kind of quantitative data from gene and protein experiments directly within the pathways (colours represent the...experiment data is done over the gene or protein names and their accession numbers. Furthermore the user...
 
genmappbioinformaticsncbibiocartamicroarrayproteinbiologykegggeneanalysispathwayaffymetrixexperimentsequenceanalyseannotationbioscience
...Look at the Proteins and DNA in stereo without any glasses. Using...sight) can see 3D Stereo image of complex proteins on a full screen, using simple and the...You can use VisProt3DS to look at the Proteins and DNA in stereo for the scientific goals,...
 
visualizatorsciencemoleculemolecular biologypdb visualizationprotein visualizationprotein vizualizerprotein viewerprotein structurepdb vizualizerstereo glassesanaglyphpdb viewer
BioMolecula 3D ScreenSaver

Shareware by TERMINAL Studio
16 x 422Kb downloads

...Acid - storage of genetics information) and two proteins - Hemoglobine I Monomeric (Oxygen transport protein) and...Cytochrome C 550 (this protein has wide range of functions). In further versions...models available only in registered version. Models of protein molecules are represented only by the main polypepthide...
 
biologicalproteinmoleculednascreensaverfictionscience
Nutrition Calculator

Shareware by Ballogun software
2 x 5000Kb downloads

...Nutrition Calculator. Now to be in form is much easier! Easy search, intuitive interface of the program will be a pleasant addition to its useful features. Database of program contains...
 
carbohydrateathletenutritionrecipeweightfatchangingcalculatorcalorieweights changesproductproteincalculate
BioMolecula WallPaper

Shareware by TERMINAL Studio
11 x 374Kb downloads

...Acid - storage of genetics information) and two proteins - Hemoglobine I Monomeric (Oxygen transport protein) and...Cytochrome C 550 (this protein has wide range of functions). In further versions...models available only in registered version. Models of protein molecules are represented only by the main polypepthide...
 
organicbiologicalsciencedesktopproteinfictiondnawallpapermolecule
SMARTbar protein bar

Freeware by SMARTbar protein bar
14 x 1428Kb downloads

...Squeeze Page Builder software offers the easiest and fastest way to create high converting squeeze pages on instant demand. You can create unlimited amount of squeeze pages customized according to...
 
squeeze page builder softwaresmartbarprotein bar
3D BioMolecula Pack

Shareware by TERMINAL Studio
12 x 612Kb downloads

...Acid - storage of genetics information) and two proteins - Hemoglobine I Monomeric (Oxygen transport protein) and...Cytochrome C 550 (this protein has wide range of functions). In further versions...available only in the registered version. Models of protein molecules are represented only by the main polypepthide...
 
biologicalproteinsaverdesktopwallpaperscreensaverdnasciencemoleculefiction
NutriGenie Mother of All Diets

Shareware by NutriGenie
10 x 1300Kb downloads

...as convenient household units. It automatically calculates the protein - carbohydrate ratio in your daily diet and...dieters can use MAD to count their carb, protein and fat grams. Percentage of calories from carbohydrate,...
 
diabetesdiseasesnutritionfatnutrigeniecookingfoodweightmedicationdiethealth
BioSeqAnalyzer

Shareware by BioSeqAnalyzer
12 x 566Kb downloads

...a bioinformatics software tool for analyzing DNA and protein sequences. Its Windows interface makes sequence analysis extremely...functions can be performed on both DNA and protein sequences. BioSeqAnalyzer brings to sequence analysis the following...
 
proteinlocal alignmentmultiple alignmentdnaaffine alignmentglobal alignmentbioinformaticsbioseqanalyzeracgtsequence analysisbiotechnologyhidden markov models
...3D structure of such complex Biological Macromolecules as Proteins and DNA in 3D STEREO mode on your...of Biological Macromolecules (VisProt3DS) you can look at Proteins and DNA (in PDB format) by the simplest...at least of a part of large complex protein molecule by VisProt3DS Cube mode (Please see the...to look and interactively analyze 3D structure of Proteins and DNA in 3D STEREO mode for the...
 
pdb visualizationpdb viewerstereopdb visualizerprotein visualizationprotein viewerprotein visualizeranaglyph
Simplebean Health Guide

Freeware by fore royal, llc
28 x 400Kb downloads

...The free Simplebean Health Guide quickly calculates your health statistics and targets. To plan a healthy diet, you get important health information such as your Body Mass Index (BMI), Basal...
 
caloriescarbohydratecalculatorproteinagefathealthdietweight lossheight
Wheat Mill

Freeware by Grain Mill
4 x 509Kb downloads

...and germ. Whole wheat flour is higher in protein than white flour milled from the same wheat....
 
wheat grindercorn grindergrain millblendtec total blenderblendtec blenderflour mill
NutriGenie Optimal Nutrition

Shareware by NutriGenie
14 x 1600Kb downloads

...can use Optimal Nutrition to count their carb, protein and fat grams. Percentage of calories from carbohydrate,...
 
glycemic indexfatcookinghealthweightdiabetesmedicationdiseasesnutrigeniedietnutritionfood
FoodCalc

Shareware by SleekTools
11 x 16303Kb downloads

...track your daily intake of Calories, Fat, Carbohydrates, Protein and Cholesterol. It comes with a comprehensive database...Keeps track of calories, fat, carbohydrate, cholesterol and protein contents ยท Comprehensive database of foods with up-to-date...
 
fatcarbohydratestabletcaloriescarbsnutrition calculationumpcdietproteinfreefood databaseweight lossfood diarycalculatecountercalculatornutrition softwarefoodcalcsodium
Diet Spread

Shareware by Standard Procedures
11 x 1188Kb downloads

...Diet Spread is a lightweight spreadsheet/database. The database accepts nutritional values from your food labels. The spreadsheet displays, summarizes, and...
 
carbohydraterecorderfatplayersoundlow carbmp3proteinwinampfreewaresharewaremidisouth beachaudiospreadsheetweight lossmusicatkinscarbzonesugardiet
eeCarb - Hidden Low Carb Calculator

Freeware by nr4
21 x 355Kb downloads

...A Low carb Calculator to find unlisted carbs based on a food products nurtrition label. This calculator will tell you if there are any uncounted Carbohydrate grams on the food...
 
calculatorcarbohydratehidden
acai berry

Freeware by acai berry
5 x 1051Kb downloads

...Acai berry also is a rich source of protein and dietary fiber, in addition to high levels...
 
acai berriesacia berryacai berry onlinebuy acaifree trial acai
Paraben`s Diet Tracker

Shareware by Paraben Corporation
13 x 4276Kb downloads

...is right for you.~~You can track Fat (grams), Protein (grams), Carbohydrates (grams), Cholesterol (milligrams), Sodium (milligrams), Calories,...
 
drinkcounternutritiontrackerfoodusdacaloriediet
GENOM 2005

Demo by GSA
40 x 3441Kb downloads

Free Vista Files award
...Genom 2005 is a feature rich and user friendly application for analysing array-experiments (e.g. from provider Affymetrix). It includes normalisation of raw data, additional gene information official gene...
 
function predictionbiosciencencbiprobesetbiologymicroarraypathwayaffymetrixsequencebiocartaanalysegenmappdnakeggprotein