1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AptiStock

Freeware by AptiStock
111 x 5835Kb downloads

...It is simple and powerful that more expensive charting tools cannot match....
 
free softwarestock analysis softwarebull marketbear marketaptistockfree eodstock charttechnical analysischarting toolsfree stock softwarestock marketend-of-day
...UML projects. Feature List: +Support UML 2.1 +Business Process diagram +Mind Mapping +Requirement Modeling with automatic generate...requirement ID (Enhanced) +Event-driven Process Chain +Organization Chart +Navigate between operation and sequence diagram (New) +Better...
 
analysissoftwaremacdesignjavaoodmodelsreverse engineeringmodelling toolsrational rosecode generationpluginsuse casesobject orientedvisual paradigmclass diagramsuml toolslinuxuml diagramsadd-ins
...generate documentation. SDE-NB Features: +Support UML 2.1 +Business Process diagram +Mind Mapping +Requirement Modeling with automatic generate...requirement ID (Enhanced) +Event-driven Process Chain +Organization Chart +Navigate between operation and sequence diagram (New) +Better...
 
object orientedmodeleruml diagrammodeling toolpluginjavause casecode generationsoftwaredesignclass diagramanalysismacrational roseadd-inreverse engineeringvisualuml toollinuxnetbeansood
...UML projects. Feature List: +Support UML 2.1 +Business Process diagram +Mind Mapping +Requirement Modeling with automatic generate...requirement ID (Enhanced) +Event-driven Process Chain +Organization Chart +Navigate between operation and sequence diagram (New) +Better...
 
add-insmacpluginsobject orienteduml toolsreverse engineeringmodelsoodcaserational rosedesignuml diagramsvisual paradigmmodelling toolsuse caseslinuxclass diagramsjavasoftwarecode generationanalysis
OrgPlus

Shareware by HumanConcepts LLC
28 x 32345Kb downloads

...that wish to create and distribute standardized organizational charts for planning and communication purposes. No drawing skills...are required to create great-looking organizational charts with OrgPlus. You`ll never have to manually position...or connect the boxes in your chart again. OrgPlus creates organizational charts automatically from virtually...HR systems and directory services.
 
organizational chartorg chartorg chart software
Universal Software Oscilloscope Library

Freeware by oscilloscope-lib
37 x 3627Kb downloads

Free Vista Files award
...relayed data is instantly displayed in beams, the process of their relay and display is deterministic. It...
 
simulationgui dllchartgraphical user interfacedata acquisitionsoftware oscilloscopedebuggingreal-time plotnetwork monitoringlibrary
TurboCASH

Freeware by Dynamic Bottom Lines
84 x 33325Kb downloads

...friendly interface * Comprehensive, context-sensitive help * Customiseable chart of accounts * Comprehensive Set of Reports, especially...with TurboCASH`s general ledger * Internet Access - Process transactions from remote sites over the Internet *...
 
turbocashbusiness softwareinventorypoint salesinvoiceaccounting software
IP Traffic Monitor

Shareware by Skyward Software
27 x 7000Kb downloads

...last activity of this connection, name of the process that initiated or accepted this connection, full path...to the application the process belongs to, etc. The traffic summary indicator shows...and traffic totals. In addition it draws pie chart diagrams that illustrate the percentage of certain hosts...
 
networklanmonitoringtrafficuploadactivity
NetWatcher

Shareware by Toleron Software
22 x 802Kb downloads

...loaded modules (plug-ins), which gather network status information, process and display statistics as well as log the...
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping
Edraw Flowchart Software

Shareware by EDrawSoft
35 x 21464Kb downloads

Free Vista Files award
...Edraw is a new flowchart software, which creates flowcharts and business charts with minimum time loss for...charts, business charts, hr diagrams, work flowcharts, programming flowcharts and network design diagrams. Top 10 Reasons to...business charts, hr diagrams, work flowcharts, programming flowcharts, process flowcharts and network design diagrams. 3. Typical examples....
 
tqm diagramflowchart toolorg chartflow chartsdl diagramsflow diagramflowchart softwareepc diagramflowchart makerflowcharterprocess flowchartidefdata flow diagramflowchart templateflowcharting
InstantInvoice 3

Shareware by EzySoft Developments
11 x 1954Kb downloads

...and quotes. Preview and print powerful reports and charts instantly like invoice listings, sales by customer, outstanding...list, customer statements and more. View a graphical chart of your monthly invoice totals to track your...levels of tax (e.g. Canada). Able to subsequently process a sales report with tax breakdown. Now able...
 
proposalsinvoice softwarequotesinvoicingcreate invoicebilling softwaresmall business softwareestimates
Site Statistics

Shareware by NetPromoter
19 x 15392Kb downloads

...your site in the form of an interactive chart and decide on the effectiveness of the site...
 
site promotionwebsite counterstatistics analysissite statisticssite optimizationlog analyzer
Java Chart Designer

Shareware by ELTIMA Software GmbH
14 x 2847Kb downloads

...Java Chart Designer is a powerful charting Java application that empowers you with all necessary...tools to create charts for professionally looking presentations, business and scientific reports...interface, great number of visual effects and predefined chart types, flexible chart components selection, powerful animation and...on-screen real-time chart visualization make Java Chart Designer usage an easy and delightful experience.
 
java graphsjava chart designerbuild java chartsjava chart applicationjava script chartsdesign charts java
Flow Diagrams Software

Shareware by AnyDrawSoft
10 x 3669Kb downloads

...design software. Create flow diagrams, organizational charts, program flowchart and other business and technical diagrams rapidly. Abundant...flowchart templates, flowchart symbols and flowchart samples will help to quickly create most common...is what you get. Feature: 1. A new flowchart software, which creates flowcharts with minimum time loss...
 
create flow chartprocess flowchartflowchartingflowchart makerflowchart exampleflow diagramsflowchart toolflow chart symbolflowchart designorganizational chartdraw flowchartflowchart templateorg charts
EDGE Diagrammer

Shareware by Pacestar Software
16 x 5537Kb downloads

Free Vista Files award
...Professional diagramming, flowcharting, and design tool. Uniquely tailored for easy use with little or no training required. Create any type of block or flow diagrams. Use built in shapes and...
 
drawflowchartingsoftwaredataprocessentitydiagramnetworkorgchart flowcomputerprogramdesign
PDF Chart Creator Command Line Tool

Shareware by Utility Warrior
32 x 291Kb downloads

...The PDF Chart Creator Command Line Tool is a simple utility...that can convert data into a variety of charts as a PDF document. The chart creation process...or referenced from within other "command" files. PDF Chart Creator is NOT an Adobe Acrobat plug-in and...include: Automatically create bar charts, pie charts, line charts and area charts as PDF documents using a...command line or batch file interface.
 
pie chartpdf chart creatorline chartset bookmarksarea chartbar chartroyalty freepassword protectcreate pdf graphscreate pdf chartspdf graph creator
PDF Chart Creator Dynamic Link Library

Shareware by Utility Warrior
21 x 401Kb downloads

Free Vista Files award
...The PDF Chart Creator Dynamic Link Library (DLL) allows you to...create area charts, bar charts, line charts and pie charts from data as high quality...PDF documents. The conversion process is fully controlled through the provided Application Programming...the utility in their own application. The PDF Chart Creator is NOT an Adobe Acrobat plug-in and...
 
password protectpie chartline chartcreate pdf chartsdynamic link librarypdf graph creatorroyalty freebar chartdllcreate pdf graphsset bookmarksarea chartpdf chart creator
PocketChart

Commercial by MindFusion Limited
10 x 1029Kb downloads

...framework. It helps you create and present workflow, flowchart and process diagrams, database entity-relationship diagrams, organizational, hierarchy...
 
diagramwindowsnetworkprocesshierarchyframeworkcompactworkflowflowchartcontrolorganizationalpocketpc
Task Administrator

Shareware by Saturn7
15 x 885Kb downloads

...Remote process monitor with Alert function and advanced process analyse. Allow lookup remote computer process list, realtime...data filter. Enable 4 process group by right. Windows domain or windows workgroup...graphical chart. 5 different type of statistics and chart graphical. Many filter options....
 
windows domainmonitoringremote processadministratornetworkwindows workgroup
Pacestar UML Diagrammer

Commercial by Pacestar Software
15 x 7011Kb downloads

Free Vista Files award
...best aspect of UML, the standardized visual design process without imposing a cumbersome project methodology. And it...simplifies this process so that you can be productive immediately with...
 
stateorientedumlunifiedsequenceobjectlanguagemodelinguml2casepackagedrawcomponentdeploymentdesigncollaborationchartclassactivityusecase