Sort by : ReleasedNameDownloadsAddedRatingRelevance
MapMaker for PalmaryClock

Freeware by PalmarySoft. Ltd
138 x 669Kb downloads

...for PalmaryClock is a freeware special easy-in-use visual tool for map creating. This product allows making maps...
 
jpgoriginalcreatetoolpowerfulgraphicpalmpalmaryclockeditnicemapgif
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and...database template to customize everything´╝ü So this SQL tool can help you work more efficiently. It has...string or numeric constant in the edit area. Powerful edit function such as Copy, Paste, Cut, Redo...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
PicaJet Photo Organizer

Freeware by PicaJet.com
161 x 5064Kb downloads

Free Vista Files award
...find any category using intuitive visual cues. PicaJet`s powerful search function makes locating a group of photos...
 
photo organizerphoto organizingphoto gallery softwarephoto management softwarephoto album softwarecataloging tool
DBDesigner 4

Freeware by fabFORCE
688 x 7365Kb downloads

...source MySQL-Database to support MySQL users with a powerful and free available design tool. All MySQL specific...
 
designerdatabasemysqlfabforcesourcedbdesigner
InstantCharts Messenger for Traders

Freeware by ASSISTANCE LLC.
82 x 2082Kb downloads

...quote lists, news and charts. A very useful tool for the trades displays data for trades in...and sales information and easily accessible charts. This tool which has been developed in Java can be...the reliability of our service. A simple yet powerful tool is fully customizable which helps to tune the...
 
quotejavajabberstocknysemsnyahoomessengerchartsxmppicqinstant
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...entirely by you not the software The webmasters tool will only pre-populate web pages and not auto...Podcast, Shareware and Freeware sites. With the webmasters tool you will never waste time and money on...targeting the wrong keywords again. The webmasters tool is able to check MSN, Yahoo and Google...by Overtures keyword suggestion tool. Automation The webmasters tool contains shortcuts for everyday webmasters tasks Site: Google...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
Spellasoft Video Converter Professional

Shareware by Spellasoft
32 x 13897Kb downloads

...to video file conversion program available today. Our powerful encoding engine can convert just about any type...Spellasoft Video Converter Professional is the video conversion tool of choice amongst the video community...
 
convert video files dvdvideo file converterconvert pspconvert xvidconvert ipodconvert divxconvert mpeg4video converter
PixGrabber Free

Freeware by SoftInform
74 x 4296Kb downloads

...just a handy image viewer but also a powerful tool for image archive managing. Images can be collected...the process of importing. Even more, PixGrabber is powerful bookmark manager and allows adding your personal comments...
 
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in validation. Rookies, get...why the HTML Editor comes with three different tools to correct human error and ensure that you`re...tags. Last but not least, a built-in validation tool allows you to check your code using W3C...in HTML 4.01, XHTML 1.0, or HTML5, these tools have you covered....
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Alarm Me

Freeware by Qytec
211 x 997Kb downloads

...No words for this excellent alarm tool. "Alarm me" can be your favorite time organizer as it is powerful, regarding its capabilities, and its user interface is great. Includes general...
 
remindershutschedulecountdowndiaryshutdownalarmrestartaddresstimercalendar
...catalog and digital marketing Software) is an ideal tool for an enterprise to - manage catalog products...
 
digital marketingdigital catalogemail campaignssales presentationscatalog presentationsemarketing
Back2zip

Freeware by Free-backup.info
176 x 523Kb downloads

Free Vista Files award
...we call Back2zip. Back2zip uses the industry`s most powerful ZIP and ZIP-64 technologies to constantly monitor your...backed up to ZIP files. Back2zip is so powerful that it can work away completely in the...
 
compressiontoolpkzip1st choiceself-extractingfreezipwinzipstuffitebooksecond copyultimateziprestore7-zipquick zipsfxutilitybackupzipitfast
Flashpaste Lite

Freeware by Softvoile
143 x 765Kb downloads

Free Vista Files award
...numerous times before. Flashpaste is also a handy tool for web developers or web designers to easily...
 
clipboard utilitiesinstant pasteinsertionclipboard historypaste textinsert text
MakeSurvey

Freeware by Baltsoft
129 x 879Kb downloads

Free Vista Files award
...MakeSurvey is a powerful and interactive survey management system, enabling to organize,...
 
survey onlinecreate online surveyhow create surveyweb surveysonline survey toolonline surveysconduct surveyonline survey softwarefree online survey
Free Vista Files award
...for SQL Server Freeware is a high performance tool for Microsoft SQL Server database development and administration....with compression and other. It offers plenty of powerful features for efficient SQL Server administration. SQL Manager...all SQL Server objects * Advanced data manipulation tools * Effective security management * Excellent tools for...Easy-to-use wizards performing SQL Server administrative tasks * Powerful tools to make your work with SQL...
 
mssql toolssql server create databasesql server querysql server client toolssql server toolssql server database designsql server administration
Free Vista Files award
...Manager for MySQL Freeware is a high performance tool for MySQL database administration and development. It works...of all MySQL objects * Advanced data manipulation tools * Powerful security management * Excellent tools for...
 
mysql create databasetools for mysqlmysql managementmysql toolsmysql server toolsmysql schemamysql administrationmysql sql querymysql database developmentmysql database toolsmysql client toolsmysql gui
AlphaControls Lite Edition

Freeware by AC Team
93 x 2328Kb downloads

...using "AlphaSkins". AlphaControls is an easy-to-use universal and powerful tool for developing original skinned and non-skinned business/media applications....
 
advancedgradientalphablendapplicationsbordersbuildingblendingtransparentskinablepagecontroldesigndelphialpha blendedshadowvclskinned componentsgrayedthemesinterface
Pivo Whois Component

Freeware by Pivo Corporation
69 x 232Kb downloads

...Whois Tool is a client utility that communicates with WHOIS...IP network, or an autonomous system number. A powerful but easy to use whois component which is...domain on its own and query them. This tool is perfectly suited to hosting companies who wish...
 
domain informationserver componentasp net componentasp componentwhoisregistrar
Free Vista Files award
...Manager for PostgreSQL Freeware is a high performance tool for PostgreSQL database administration and development. It works...others. SQL Manager for PostgreSQL offers plenty of powerful database tools for efficient PostgreSQL administration. SQL Manager...Features * Support of UTF8 data * Excellent tools for query building * New state-of-the-art graphical user...database management and navigation * Advanced data manipulation tools * Improved database...
 
dump postgresql databasepostgres querypostgresql sql querypostgresql create databasepostgresql client toolspostgresql toolspostgres toolspostgresql database toolspostgresql guitools for postgresql
Free Vista Files award
...EMS SQL Manager for InterBase/Firebird Freeware is a powerful tool for InterBase and Firebird database administration and development....incremental backups, and others. It offers plenty of powerful database tools for efficient InterBase/Firebird administration. SQL Manager...support editors * Effective security management * Excellent tools for query building * Easy-to-use wizards performing InterBase...
 
firebird database toolsinterbase toolsinterbase queryinterbase client toolsfirebird client toolsfirebird queryinterbase firebird tools