1 2 3 4 5 6 7 8 9 10

Sort by : ReleasedNameDownloadsAddedRatingRelevance

Shareware by IP Detective
14 x 4881Kb downloads

...*Customizable reports *Display shared resources *Network Asset/Inventory *Port Scanner *Dynamic...
 
networkaddressmonitor
Network Configuration Management

Shareware by Missilesoft
24 x 3937Kb downloads

...of utilities that manage network config, diagnose and monitor network, it includes: IP Manager: create different TCP/IP...a configurable, graphical display. Socket to Process Mapper: monitors all open TCP and UDP ports in your...local computer, and maps ports to owning application so you can find out...
 
diagnosenetworkwhoisrecoveryprocesstaskmapperasterisksocketmonitormanagementpasswordmanagerconfigurationbandwidth
Network Eagle Monitor

Shareware by Extromatica
12 x 4367Kb downloads

Free Vista Files award
...Network Eagle Monitor is a network monitor designed to inform you of network problems before...your clients, end-users or managers do. You can monitor the network, servers, network services, hosts, devices, applications...databases. By running regular checks, the program proactively monitors the critical devices for availability and health and...a log file for future reference. Network Eagle Monitor lets you get started right out of the...
 
network monitordiagnostic softwarenetwork management softwarenetwork monitor softwareserver softwareserver monitorport monitoring softwaretcpip softwarenetwork server software
Advanced Administrative Tools

Shareware by G-Lock Software
18 x 3087Kb downloads

Free Vista Files award
...Have you been port scanned lately? Completely ignoring network security is not...do this effectively, you have to know what ports are available and what application is utilizing them....AATools Network Monitor displays the services that are active on all...ports. Further, AATools Network Monitor maps the ports in use to their respective applications (this feature...simple and easy solution to tracking application to port maps.
 
verifierscanneraatoolsemailregistrynetworkproxyanalyzermonitorportcleaner
Tail4Win

Shareware by Withdata Software
17 x 2067Kb downloads

Free Vista Files award
...- windows tail. Tail4Win is a real-time log monitor and viewer, is a windows port of the...growing file. By using Tail4Win system administrator can monitor log files of server applications in real-time, e.g....IIS, Tomcat, Resin log files. And programmer can monitor application traces easy and quickly. Tail4win can display...makes no changes to log files. Main fetures: Monitor changes to files and display the changed lines...in realtime.
 
windows tailwin tailtail logwintaillog monitor
Network Eagle Monitor Professional

Shareware by Extromatica
14 x 4612Kb downloads

Free Vista Files award
...Network Eagle Monitor Professional is a network monitor designed to inform you of network problems before...your clients, end-users or managers do. You can monitor the network, servers, network services, hosts, devices, applications...databases. By running regular checks, the program proactively monitors the critical devices for availability and health and...a log file for future reference.
 
port monitoring softwareserver monitortcpip softwarenetwork management softwarediagnostic softwareserver softwarenetwork monitornetwork server softwarenetwork monitor software
sMonitor

Shareware by Alexander Yarovy
19 x 5732Kb downloads

...A server uptime monitor is a must-have for any business which provides...highest degree of reliability of their networked resources. sMonitor presents a server uptime monitor which will constantly...window of the program. It provides a thorough reporting system including the ability to save files in...as well as both visual and audible alerts. sMonitor supports TCP, UDP and ICMP and it can...to DHCP, NTP, NETBOIS, SNMP and LDAP ports.
 
network monitoringport statusserver uptime monitortcp portsnetwork serversudp portsserver monitornetwork servicesping
EzDNS

Demo by ezdns.com
10 x 2266Kb downloads

Free Vista Files award
...EzDNS publishes and/or e-mails your PC`s local LAN IP and global WAN IP address, currently running processes and connection information to a remote web page or text...
 
popproxyhostezdnsprocesscabletcpsharewareprotocolpageaddresshttpofflinefrantzensofturlinternetdsllandeveloperportmonitoronlinepublishlocal infopostersocketdomainfirewall
Cisco CDP Monitor

Shareware by TallSoft
23 x 1376Kb downloads

...Cisco CDP Monitor is a highly efficient network monitor and troubleshooting tool for network administrator and network...engineer. First, Cisco CDP Monitor is a CDP Client for windows host. It...devices, such as device names, device models, connecting port , administive ip address, IOS version, VTP Domain...the setup of Cisco device changed), Cisco CDP Monitor will detect and display related info. So as...
 
cdp clientcisco clientcdp agent
10-Strike LANState

Shareware by 10-Strike Software
40 x 5771Kb downloads

Free Vista Files award
...the result as a map with images. 2. Monitoring hosts (ICMP ping and connecting to TCP port...are supported). 3. Monitoring the usage of your shared resources by other...users of the network. 4. Monitoring load of your network card (incoming/outgoing traffic). 5....
 
computer10-strikediagramscannertcpremotemapadministratorhostmappingdnsdevicenetworklanstatemacshutdownrestartmonitoringreboot
...NETObserve is a sleek, powerful remote administration and monitoring solution for home and business environments. NETObserve allows...or outside a network) and moderate, administrate, and monitor the machine`s activity. NETObserve`s remote administration features include...editing, startup process moderating, favorite place viewing, open port and connection records, real-time access and moderating of...
 
spy softwareremote computer monitoringkeyloggerweb based administrationexploreanywherekey loggerremote administrationnetwork adminnetwork surveillanceremote spynetwork monitoringspyanywhereremote computingnetobserve
Serial Monitor Protocol Analyzer

Shareware by HHD Software
21 x 5685Kb downloads

Free Vista Files award
...Software serial port monitor Rs232 sniffer with protocol analyzer and packet data...logger. This monitoring utility can spy, capture, view, log, analyze, test...com ports activity performing com port connection and traffic analysis with data acquisition and...modem data transfer viewer and so on. Serial Monitor can be successfully used for monitoring data flow...
 
analyzerpacketsoftwareprotocolsnifferlogserial port monitorportsconnectionviewerutilityspydataloggermodemcapturemonitoringtoolrs232
Nsauditor Network Security Auditor

Shareware by Nsasoft US LLC
38 x 9556Kb downloads

Free Vista Files award
...network security scanner that allows to audit and monitor remote network computers for possible vulnerabilities, checks your...wide range of tools for network auditing, scanning, monitoring and more. You can discover network services and...variety of network attack probes, such as stealth port scans, HTTP / CGI server auditing, registry auditing....OS fingerprints which are not included in database. Reports can be generated in HTML and XML format....
 
network securitynetwork scannerenterprise securitynetwork monitoringport scanport scannercomputer securitynetwork auditingnetwork toolsnet toolsnetwork utilsnetwork softwareinformation security
X-NetStat

Shareware by Fresh Software
37 x 441Kb downloads

...see the address you are connected to, what ports (local and remote) are being used, the connection...
 
statsudpport monitorfirewallsnmptcpicmpnetworkx-netstatwhoistrojanconnectionshackerxnsfinwaittracerouteserverestablishedkillfinger
LANView

Shareware by JXDEV
17 x 2800Kb downloads

...remote shutdown, remote wakeup, lookup host, trace route, monitor connections, audit SNMP, find computer, ping, display network...
 
trafficlancapturewinsockmonitorsearchscanpacket
Free Vista Files award
...DEKSI Network Monitor is an advanced, powerful, and multi-featured network device...in responding to any possible downtime. DEKSI Network Monitor periodically polls devices a the network map and...and tries to connect to the requested TCP Port over your network. If the check is successful...down a service or a computer. DEKSI Network Monitor scans a local area network and automatically retrieves...the list of all available hosts.
 
tcp monitorserver monitormonitoring softwarenetwork managementserver monitoringnetwork monitoringnetwork monitoring softwareport monitorwebsite monitoringnetwork device monitornetwork administration
ManageEngine OpStor

Commercial by ZOHO Corp.
12 x 39739Kb downloads

Free Vista Files award
...OpStor is a multi-vendor storage monitoring software offering unified Inventory, Fault and Performance Management...Host servers through a web browser. Major Devices supported are: EMC Clariion, EMC Symmetrix, HP EVA, HP...Infortrend, Brocade, Cisco, DELL, ADIC, QLogic, Emulex. OpStor monitor SAN devices using industry standard interfaces like SMI-S,...generates alarms on status changes.
 
monitoring san networkssan storage solutionsvmware esx monitoringemc clariionstorage monitoring softwarebrocadeevaemc symmetrixinfortrendnetapp
...New Game Server Monitoring & Management System. IpMasterPro sniffs, or monitors, Internet...that does not pertain to Ip addresses and/or Port numbers you desire to examine or track. Compare...
 
serveripmasterpronetworkfirewallgamesmgmttcpipipwallmastermonitor
NetworkGazer

Commercial by DoubleUp Software
13 x 2073Kb downloads

...NetworkGazer is valuable tool that allows you to monitor and maintain your network by giving you a...Find out what programs are associated actual open ports on the remote computer. Network administrator will find...feature handy if a virus has opened a port on an end-user PC. Manage remote computers with...by sending magic packet. NetworkGazer also comes with report processing capabilities for full system management documenting....
 
wake-on-lanschedule tasksnetwork adapterprocessornetwork shareswakeonlanopen portsnetwork documentingevent logsinternet historymac addressshutdownrebootdisk drives
...ipPulse is a Connectivity and Device Status Monitoring Tool. Use ipPulse to monitor the status of...ranging from audible messages to email and logging. Supports a large list of target hosts entered as...hostnames or IP addresses. The list can be imported from a text file. Polls the list on...full control over the list cycle timing parameters. Supports a primary and secondary test. Supports standard Ping...ICMP Echo Requests/Replie.
 
networktcp connectstatuslogmonitoremailnotifyconnection testtcpipping