1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...Outlook (2002/2003/2007) and the Groupware server. Any standard POP3 and IMAP4 client can be used to access...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows combining...avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged sender...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
IPCheck Server Monitor

Freeware by Paessler AG
103 x 30723Kb downloads

Free Vista Files award
...Oracle. Network management notifications can be triggered by server uptime, downtime, changed webpages, or slow responses. Messages...
 
pageripcheckpop3serverpingftpporthttpssnmpuptimetoolsmtpdowntimeicqmonitoringnetwork monitorsmsdns
IPCheck Mobile GUI

Freeware by Paessler AG
65 x 97Kb downloads

...IPCheck Mobile GUI helps organizations monitor critical network resources and immediately detect system failures or performance problems on a PocketPC, using Paessler`s IPCheck™ Technology. Various sensor types including PING,...
 
pop3httpssmtpdowntimetoolmonitoringdnsipcheckpinguptimeftppagerserversnmpicqportsms
Bello Network Monitoring WinGUI

Freeware by Paessler AG
79 x 1287Kb downloads

...Our on-demand monitoring service makes it easy and affordable to detect network and website failures early, minimizing downtime and avoiding economic impact. bello network monitoring service periodically checks your...
 
pop3httpspaesslersmsdowntimeserversmtpportsnmppingftpmonitoringuptimednspagerbellotoolipcheckicq
...Allows to delete the selected e-mails on the server side. - Can download complete selected message, but...
 
spame-mailpop3spam filterantispam
Pivo pop3 Component

Freeware by Pivo Corporation
92 x 232Kb downloads

...A high performance POP3 component enables ASP/ VB/ VC++/ C#/ VB.NET/ ASP.NET...COM environment applications to retrieve email from mail server based on POP3 protocol. Pivo POP3 Object supports...emails in background, capability of unlimited queued request. POP3 is a widely-deployed mail access protocol. Many programs...access POP3 message stores, and thus need POP3 configuration information. Since there are multiple configuration elements...
 
email addressasp componentemail parserserver componentpop3asp net component
Pivo InI Component

Freeware by Pivo Corporation
62 x 232Kb downloads

...INI component reads and writes Windows style INI files. It provides a comprehensive set of functions making INI files a powerful way to store application settings. There are three common...
 
asp componentpop3server componentasp net componentemail addressemail parser
Pivo Ping Component

Freeware by Pivo Corporation
70 x 232Kb downloads

...fully supports RFC 792 standard. Pivo.Ping is a server component. It requires the Microsoft .NET runtime in...
 
net componentasp componentemail addressserver componentpingpop3email parserasp net component
Pivo SMTP Component

Freeware by Pivo Corporation
101 x 810Kb downloads

...Internet use SMTP to send messages from one server to another; the messages can then be retrieved...need to specify both the POP or IMAP server and the SMTP server when you configure your...to any email address with or without smtp server as parameter. Email can contain any number of...
 
server componentasp componentasp net componentemail parsersmtpemail addresspop3ping
Spamdel

Freeware by AGM
37 x 2037Kb downloads

...lets you view and delete mail on the server before it reaches your PC and more. Advantages...utilities, Spamdel does all its work on the server which means a tremendous increase in safety against...
 
utilitydeleteanti-spamsecurepop3outlook expresssmtpfreewareanti spamsecurity
MailEnable Standard

Freeware by MailEnable Pty. Ltd.
76 x 38697Kb downloads

...SMTP, POP3, IMAP and webmail services for Windows Server 2003/2008/2013 Server systems. Its simple installation procedure and...Mail Transfer Protocol) for transmitting email messages between servers on the Internet. Some of the features of...not resolve, ban on a domain-to-domain basis. MailEnable POP3 Service:- This service provides POP3 access to users...or deny access for IP address ranges. List Server Service.
 
smtpemailemail servere-mailhttpmailweb mailmail enablepoppop3mailenable
...whatever you use) on your server, so mail server will delete all these e-mails before you get...that significantly reduces the trafic from your mail server to your computer and still prevents you from...
 
e-mailsobigmonitorvirusstoppop3
SpreadMsg Lite

Freeware by Compuquest, Inc.
22 x 664Kb downloads

Free Vista Files award
...Server. EMail scanning and retrieval is supported for POP3 and IMAP email servers. For new messages waiting,...
 
2-waytradingblackberrystormpcsinstant messagingmessagestockt900weathermonitorgsmpower lossalertinfo-on-demandx10filternetworkblackoutsmswirelessfuturestemperaturealphawarningemailcellularopen viewpager
SecExMail SOHO

Freeware by Bytefusion Ltd.
17 x 2667Kb downloads

Free Vista Files award
...SecExMail is certified to operate with all SMTP POP3 e-mail clients, including Microsoft Outlook, Netscape Mail, IncrediMail,...
 
secure emaile-mail encryptionsecure e-mailfree email encryption
AVANTRIX SafeCheck

Freeware by AVANTRIX Inc.
30 x 3416Kb downloads

...safely download information on any messages in your POP3 email account inbox before downloading the messages with...
 
precheck emailspamsafe emailvirus email
POP `N` Check!

Freeware by den fete gjengen
16 x 248Kb downloads

...in the system tray, checking your mail on POP3 servers on given intervals. It tells you when you`ve...
 
thunderbirdoutlookemailpop3servercheckloginauthenticationexpresse-mail
...Assistant is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
 
utilitiesgmail proxymail headersgooglemail proxysmtp proxyssl mailssltls mailpop3 proxyinternettransparent proxy
Mail.dll

Shareware by www.lesnikowski.com
37 x 1341Kb downloads

Free Vista Files award
...for sending and receiving email messages. Includes IMAP, POP3 and SMTP clients with SSL support. Written entirely...SSL support Automatic mail parsing when fetched from server Attachment encoding/decoding S/MIME signed emails validation and creation...
 
mimeattachmentsemailreceivetoppop3imapapopsmtpsslcomponentsendeml