1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
0$ Mass Mailing freeware Paseo

Freeware by Paseosoft
29 x 28710Kb downloads

...freeware for operations managers and developers that includes command mode and SDK. Model and generate your operational...
 
freewaremassmailingemailingtextmailse-mailingpersonalizesmtpdatabasemass mailing mass-mailingmass senderfile
Pivo Command Component

Shareware by Pivo Corporation
6 x 810Kb downloads

...An Internet utility that returns information about commands which can be executed in command line such...a component class designed for calling an external command line from within a Windows Forms application (or...receiving its text output. This works for stand-alone command line applications as well as for commands invoking...the Windows command line processor (so-called DOS commands).This is an Internet...
 
smtpserver componentpop3email parserasp net componentasp componentcommandemail addressping
Free Vista Files award
...protocols used for each port, Trace Route, Ping, command Tester, HTTP server, DNS Lookup and a worldwide...Log. Now It brings the Connection Watcher software. PingCheck lets you ping a list of servers and...
 
scannertraceterminaltcpipnetworkhttpnetworkingwinsspeedserverbandwidthinternetsmtprouteconfigdhcprouterlookuppingmeterwhoismaildnsport

Shareware by SolarWinds.Net
11 x 94308Kb downloads

Free Vista Files award
...problem. You never have to use a router command line prompt again with the SolarWinds Cisco Router...
 
vpntrapstoolsciscosecurityreportingdiscoverydnsmonitorrouterpingqosalertbandwidthnetworkingtraceroutenetwork managementicmpwirelessmibinventorysnmpvoipsolarwinds
Pivo SSH Component

Shareware by Pivo Corporation
12 x 810Kb downloads

...Pivo SSH was developed for commercial organization for securing remote shell access. The protocol supports compression and tunneling multiple TCP connections over one secured connection. Pivo SSH supports various authentication...
 
commandemail addressasp net componentpop3smtppingsshemail parserasp componentserver component
Pivo Security Component

Shareware by Pivo Corporation
8 x 810Kb downloads

...Modern software must be more than secure, it must be unbreakable. No home-made solutions, nothing like that. The proven way is complete power of standard-based software components which...
 
server componentemail addressnet componentasp net componentsecuritypingasp componentsmtpemail parsersshpop3command
GEO Spider

Shareware by Oreware.com
22 x 17260Kb downloads

...Now you can trace your network activity on world map. GEO Spider helps you to trace, identify and monitor your network activity on world map. You can trace any website...
 
whoissmart routeping commandworld maproute mapgeo locationgeo spidertrace route mapvisual traceroute
Pivo Power Pack Component

Shareware by Pivo Corporation
4 x 810Kb downloads

...with a request. We are very interested in helping you develop your applications in a quick, stable...
 
securityserver componentpower packsmtpasp componentcommandpop3email parsersshemail addresspingasp net component
A1 Sitemap Generator

Shareware by Microsys
62 x 12814Kb downloads

Free Vista Files award
...website copy. Integrated FTP sitemap upload. Can also ping and notify search engines of sitemap changes. Command...project, scan website, build sitemap, FTP upload and ping search engines....
 
seosoftwarecustomervicessitemap generatorcodereviewanalyzedevelopmentwebsite
PingCOPA Network Tools

Shareware by InterVations, Inc.
14 x 6415Kb downloads

...problems by speech or email. Run simultaneous multiple ping and traceroute sessions. Traceroute is available in both...to determine subnet masks and ranges, and various command line tools are provided to monitor your machines...network configuration. PingCOPA network monitoring software can alert you of a...functions remove the need to go to the command line making lookups easier. There is more to...
 
network toolsnetwork monitoringtraceroutetracertnslookupwhoispingcopa
Mini-Comm

Shareware by Mini-Tools
10 x 2662Kb downloads

...new instance runs, it will automatically pass its command line arguments to the original instance of your...communicate with other processes, logs messages, and provides ping and other system functions. * Mini-Comm includes a...
 
interprocessvbnetsingleipccommunicationsinstance
PingIT

Shareware by Desktop Software
11 x 198Kb downloads

...or not), who are tired of running standart ping application in the command line dozens of times...
 
portmonitorutilitiestrayserverstatussocketnetworksystemwebcheckwatcherpingitserviceicmploadingadresspinger
Automize

Shareware by Hitek Software LLC
12 x 43090Kb downloads

...Schedules can be synchronized to allow or prevent overlapping schedules. Dynamic variables allow for advanced automation solutions....
 
web downloadwindowsautomation softwarebatch filesecure ftpautomizescriptautomatetask schedulercommand line
...it may just be too busy to reply). HiPing supports command line parameters and HTML file format...
 
servericmp protocolmonitoring toolnetworktoolspingwinsockactivity
Quick Tftp Server Pro

Shareware by TallSoft
24 x 1195Kb downloads

...such as listing file and directory information, reverse ping network equipment. Quick Tftp Server Pro also supports...gives Telnet users full access to Windows NT command line. Telnet users can run a variety of...
 
tftp servertelnet server
AgataSoft Auto PingMaster

Freeware by AgataSoft
6 x 629Kb downloads

...AgataSoft Auto PingMaster, will automate the pinging process so that you achieve assured smooth functioning...The features of the utility are: all the ping results are represented in apprehend-able graphical and numeric...representation, it can automatically ping one or more IP addresses or domains, supports...and provides a quick view option with real-time ping statistics in tray hint. The better option rather...
 
auto pingnetwork monitoringnetwork check
Prof Shutdown LT

Shareware by Simplyware
9 x 935Kb downloads

...display a popup message dialog. Program has a command line support, log files, etc....
 
sleepwolrebootremotegrouphibernatepingschedulewakeupjobwake-on-lanpower-offshutdown
Prof Shutdown

Shareware by Simplyware
18 x 1863Kb downloads

...up. Other major features include log file maintenance, command line support, and no need for a remote...
 
shutdowngrouppower-offjobpingwakeupwake-on-lansleephibernatewolremoterebootschedule
OstroSoft Internet Tools

Shareware by OstroSoft
16 x 4873Kb downloads

...Award-winning integrated set of network (Internet) utilities. Contains scan wizard, port and domain scanners, connection, host, service mail and html watchers, ping, traceroute, netstat, ns lookup, ftp, whois, ph,...
 
watcherdomainconnectionnetstatinternetostrosoftportfingerscannertoolspingftputility
...http-ping is a small, free, easy-to-use command-line utility that probes a given URL and displays relevant statistics. It is similar to the popular `ping` utility, but...
 
web serverpingiispostapacheipv6https