1 2 3 4 5 6 7 8 9 10 11 12 13 14

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Icons from File

Freeware by Vitaliy Levchenko
421 x 1139Kb downloads

Free Vista Files award
...or EMF files and all icons as one picture to BMP, JPEG, GIF, PNG, or EMF file....the command line. There is an ability to print extracted icons (all or selected)....
 
extract iconsbmpcommand lineutilitygifexport iconsemfextracting iconsjpegexporting iconsfilesdbfhtmltoolpngicon tool
FirmTools ShellExtension

Freeware by FirmTools
90 x 520Kb downloads

...your menu when you right click on a picture file: convert, print, and thumbnail preview. Converting supports...
 
picture filecontext menuquick convertthumbnail preview
EuroSinging

Freeware by Brainscan
71 x 2590Kb downloads

...an entry or a multimedia file, create playlists, print or export database. Find out how many points...
 
picturevideoeurovisionsounddatabasesongcontest
DiagTransfer

Freeware by Alain Blaisot
60 x 770Kb downloads

Free Vista Files award
...position and paste it in a chess program. Print high quality diagrams DiagTransfer utilizes a very high...Font for its characters, enabling the user to print very high-quality diagrams. The picture above is only...preview of the results you will get a printed page using only a “ normal ” quality...get perfect quality ! Even better than diagrams printed in high quality chess books. Create PNG images...
 
captureepdpngdiagramchesspgnfairytoolreadereditorpositionfenfree
...worksheet will look like as you design it. Print your first worksheet within a minute even the...easy marking, Basic Facts Worksheet Factory will automatically print an answer key that looks just like the...the answers. - Intuitive and easy to use. Print your first math worksheet within a minute even...only selected numbers. - Save your worksheets to print later or to use in future lessons. -...humor to the worksheet.
 
worksheetdivisionmathematicsadditionteachersubtractionmultiplicationtool
Aspose.WebEffects

Freeware by Aspose Pty Ltd
27 x 1191Kb downloads

...Aspose.WebEffects is a totally FREE ASP.Net component that enables developers to Add flare to you ASP.Net website;add spice to any bland web page. WebEffects allows developers...
 
generationexcelvbachartpictureprintworksheetrangetablecreatorfreecellcreationformattingadd-inspreadsheetreportingchartingfilecreatecommentspivotauto-filterfunctionsasposewebeffectsgenerateformulas
Picture Timeclock

Freeware by Guia International
42 x 2200Kb downloads

...early clock-in and late clock-out warnings. A report prints the total hours On the clock and tip...between two dates. Records can be edited and pictures reviewed. Pictures can be stored for a number...device (Mouse) needed to clock in or out. Print preview before printing reports. If you wish to...
 
timeclocktime clocktimekeepingguiatimeclockspicturetimesheet
Baby Album - Basic Edition

Freeware by VIRTUALSOFT
60 x 7618Kb downloads

...you can give to your loved ones, or print it on paper. This software is the ideal...Internet, export your album to make CD-ROMs or print it on paper. - Use the integrated module...
 
curvevaccinationmultimediacalendarbirthfamilygrowthphotoclipsvideoalbumdiariespregnancypicturematernitybabymemoriesaudiobabieschildrenhealthbookletdiaryrecordmemorydrawing
Mihov DPI to Pixel Calculator

Freeware by Miha Psenica
47 x 205Kb downloads

Free Vista Files award
...is no inches or centimetres. But when you print out an image the printer uses a resolution...or no sense. And when an image is printed you can clearly see that the picture has...go together? An example: an image should be printed as 6x4.5 inch in 300 DPI resolution. What...not an absolute requirement (for example by your printing house), then you should probably avoid any resampling....All printers should be able to resize the image into...
 
utilityphotocalculatesizemihovpictureppicalculatorprintprogramdpi2pixelfreewareconvertpointssoftwarequalitydots per inchpixels
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...has never been easier to view images and pictures on your computer whether your images come from...files, change wallpaper, convert, rotate, resize, zoom and print images. With support for over 20 file types,...anything from professional presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of image formats,...the Microsoft Windows® shell. For uncomplicated image viewing, PictureViewer .
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Cinema Premiere Deluxe Movie Manager

Freeware by Cinema Premiere
38 x 291Kb downloads

...export your search results to a text file. Print it out or put it on your PDA...movies is as easy as clicking the thumbnail picture of the DVD cover. There are many additional...
 
freedvd managermovie organizermovie managerdivxmoviesplayer
Photo Pos Lite image editor

Adware by PowerOfSoftware Ltd.
57 x 14669Kb downloads

...version you can edit, enhance and manipulate your pictures easily. You can edit and optimize your pictures,...which include among other things Support of many picture file types (include gifs with transparent background, password...
 
digital photographyscanfiltersprintbrushesmasksphoto editorpaintlayersdrawbatchphoto editing softwarescriptsadd framesenhancingimage editorimage editing softwarespecial effectscomputer graphics
Gogo Explorer

Freeware by Gogosoft
22 x 1749Kb downloads

...Clean privacy data. 21. Save web page as picture 22. Domain completion 23. Zoom web page 24....
 
tabbed browsergogo explorerweb browserdownload toolhigh speed
Picopolo

Freeware by GDMcom mbH
57 x 63099Kb downloads

...Never again forget which picture belongs to which place. Picopolo, the innovative software...editions for print. For traditional photo prints, selected pictures can be uploaded to photo processing websites....
 
gpscoordinatesphoto administrationdigital picturespicture administrationimage organisationmaptravelsoftwarevacationfreewaregeo referencingjourneyimage editingpresentationgraphicsdigital imagesroute
MP3 EZlib Music Library/Playlist Manager

Freeware by NewBiTrix
88 x 2405Kb downloads

Free Vista Files award
...Four user-defined music rating fields plus tempo (5) Pictures (add/delete/display) (6) Automatic lyrics search (7) Playlist creation...prefix for CD writing in playlist order (12) Print functions (13) Built-in, high quality MP3 player (14)...
 
musicmp3tweaksongwriterrenameid3v2editorfreecommentslyricsprefixsearchcustomtagprintplaylistautomaticlibrarypicturequeryplayertemporpmmass
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...menu previewing, 2000+ special effects, Photoshop plugin support, picture index creation, slideshow capabilities, 3D text and shapes,...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer
AT Screen Thief

Shareware by Alex and Alex Soft
34 x 864Kb downloads

...Easy to use interface makes this screenshot maker by an indispensable tool for people who like the speed and the power at the same time. There are twelve different manners...
 
screen capturescreen grabberscreen-captureprinteditorscreenshot editorscreen copydesktop capturesnapshotscreenthiefsave picture from desktop
Free Vista Files award
...HyperSnap is the fastest and easiest way to take screen captures as imagesfrom any part of Windows screen. Combines the power of a first-class screen capture application with an...
 
game captureimage conversionimage capturebutton captureimage editscreen capturescreenshotprint screen
Easy Photo Grabber

Shareware by MSLSoft
54 x 1390Kb downloads

...to reduce hard disk use. With the built-in picture viewer you can directly view, print, scroll, or...zoom the pictures to full screen. All pictures are shown with a date-time stamp and can...be printed out single or in a range of 10....To clear the picture archive you can delete the pictures from within...
 
photomonitoringvideocamprotectionsnapshotdigital cameraguardvideo capturesurveillancewebcammotion detectionsecurity
AD Picture Viewer

Shareware by Abroad Design
33 x 1225Kb downloads

...AD Picture Viewer is the fastest, easy-to-use and compact image...as a wallpaper on your Windows desktop. AD Picture Viewer allows you to modify images using different...option makes the image collections load easier. The Picture Description feature allows you to create multiline notes...
 
viewergifbmpemfshowwmftargapicturegraphicslidepsdpddjpegimagetgajpgico