1 2 3 4 5 6 7 8 9

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Image Finder

Freeware by Netvue
149 x 316Kb downloads

...Image Finder is a program to search for pictures of your desire either by keyword or with...new location search where you can browse GPS-stamped/location-aware pictures of an area by clicking on the map!...
 
internet image searchlocation-awareimage browserpicture finderslideshowimage findermaplocation searchexifgps photo search
Web Downloader

Freeware by Jose Falcao
72 x 659Kb downloads

...Drag and drop links directly from your web browser to the software window or copy to clipboard...
 
managerfastgrabfilepicturehttpdirectorywebftpfreewarebatch
Easy Thumbnails

Freeware by Fookes Software
178 x 1038Kb downloads

Free Vista Files award
...scaled-down/up copies from a wide range of popular picture formats. An elegant interface makes it a snap...
 
batch resizingcreatescaledownloadablethumb nailsthumbslanczos3freewarejpeggeneratethumbnailspicturesresamplingjpgeasylosslessimagesresizethumnailsdigitalphotos
NotJustBrowsing

Freeware by Abdul Karim
23 x 14890Kb downloads

...(VSS) and incorporated 9. Operate computer from within browser (Zero Point) 10. Unified referencing for local storage...coded browsing signals 12. Verbial Icons 13. Encrypted Picture Messaging 14. Configurable visual representation for group of...
 
verbial iconszero pointlinear browsingtailored browsingwww-booksencrypted picture messagingpublisherresearcherweb browservery simple syndication vsssee through
12Ghosts Popup-Killer

Freeware by 12Ghosts AG
47 x 720Kb downloads

Free Vista Files award
...for any application, for example browser, media player, picture viewer, or instant messenger. A history cleaner for...
 
clickactioneventbutton
Web Site Robot

Freeware by NetForAll
48 x 25119Kb downloads

...thumbnail and builds your online photo album or picture gallery. It is very flexible and the visitor...
 
streamingonline photo albumweb servermp3javadynamic trackingweb designfreevoipno-ipvideolinuxnetforallwmaecommercecredit cardp2pweb hostingpeer-to-peere-commerceonline paymentblogshopping cartfile sharingweb site robotogg
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...has never been easier to view images and pictures on your computer whether your images come from...images. With support for over 20 file types, PictureViewer .EXE is your solution for anything from professional...presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of image formats,...the Microsoft Windows® shell. For uncomplicated image viewing, PictureViewer .
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Fast Browser Pro

Freeware by FastBrowser.net
58 x 1678Kb downloads

...Try this marvelous browser, you`ll be hooked! Fast Browser Pro version features many excellent functions, it can...and more. They are all in one, Fast Browser lets you surf the web crazily....
 
fastest browserweb browser
Pix2Fone Browser Extension

Freeware by Pix2fone.com
215 x 101Kb downloads

Free Vista Files award
..."Save Image as Phone Wallpaper" option to the browser and lets you save any picture from your...can download your phone wallpapers with the phone browser or send text message / SMS bookmark directly...
 
mobilewallpapersscreensaversphonebackgroundscellularwirelessmobile webgraphicscellphone
Inquisitor

Freeware by Jens Timmermann
51 x 9123Kb downloads

Free Vista Files award
...Inquisitor is a free, fast, save, visual Web Picture Site Ripper/Downloader/Grabber, Offline Browser to select and download...
 
offline browserimage site ripperdownloaderhttp scannergrabbermulticonnect ftp clientsave visual web picturefastfree
Crawler Browser Skins

Freeware by CRAWLER, LLC
149 x 1074Kb downloads

...Choose all kinds of IE browser skins and bring your browser to life. Find...your favorite pictures of girls, car makes, air fighters, nature scenes...of cool works of art waiting for you. Browser Skin is a feature that adds style to...your Internet Explorer browser by displaying a different background appearance to the...browser. This appearance is based upon pictures of your interest. Skins change the general appearance...
 
browser themeinternet explorerbrowser picturepictures for browserskinsweb browserbrowser skinbrowser pictures
Gogo Explorer

Freeware by Gogosoft
22 x 1749Kb downloads

...Clean privacy data. 21. Save web page as picture 22. Domain completion 23. Zoom web page 24....
 
tabbed browsergogo explorerweb browserdownload toolhigh speed
Crawler 3D Earth Screensaver

Freeware by CRAWLER, LLC
134 x 9102Kb downloads

Free Vista Files award
...fire, 3D earth, and 2D slideshow. Enliven your browser with colorful IE browser skins, choose from over...
 
earth mapplanet earthdesktop saverssatellite image earthsatellite picture earthearth satelliteearth viewerearth saverearth screensaverscreen savers
GetBot

Freeware by GetBot
35 x 321Kb downloads

Free Vista Files award
...With GetBot, you can easily get all the pictures on a page, or every video in an...the updated parts. GetBot can tell if a picture is a button, an image map, a video...
 
resumeparsedragcrawlwindowsloopwebleacherextractinternetsnatchrecoverprogramdialcollectblockscourmp3accelerategetbotleecherget botrippumpsearchhttpfixboostsoftwarestripscheduledefeatftp
Pix2Gsm

Freeware by Portpix
56 x 775Kb downloads

...use this interface that stores a list of pictures to get them ready to use if you...that is used: Now you can use bitmap picture directly without external conversion. Now with a built-in...webbrowser to select your pictures within a webpage. The price may change depending...of your country. Version 1.03 has a browser integration and allows to bookmark pictures easily for...
 
custom picture gsmbackgroundmobile

Freeware by www.smstreff.ch
87 x 5026Kb downloads

...received on mobilephone * Operatorlogos * Ringtones * Picture messages * VCards, even blinking * Any binary...and documentation of your sendings * Integrated mini browser to watch the logo collection of ASPSMS *...WAP Push SMS picture or text (drag and drop) * Sendlog with...
 
desktoplong smssendwaptooldatingmultiplemassflash smsflirtblinking sms
FotoTagger

Freeware by Cogitum LC
46 x 3298Kb downloads

Free Vista Files award
...a form of balloons. Create image macros, talking pictures and books of comics from your photos. Comment...directly from FotoTagger. Add searchable comments to individual pictures or groups of images at once. Use one...albums. Find grabbed images by source URL. Annotate pictures with FotoTagger and upload them to your Flickr...is also supported. FotoTagger lets you publish annotated pictures to blogs at Blogger.com and LiveJournal, as well...
 
livejournalnotecommentbloggerphotoannotatedflickrpublishtagsharecalloutdigitalmetadataimage macropicturetoolimageboardjpegcamera
dbQwikSite Personal Plus Edition

Freeware by Gerald Enright
26 x 13452Kb downloads

...database (ADO connection) -Seamless local testing in your browser -Integrated web site publishing -Sort, Search and filter...pages -Preview output in dbQwikSite or in your Browser -Generate picture links to data from your database...
 
freeware
Sleep Moon Xpress

Freeware by Reohix
30 x 12834Kb downloads

...dongle installed on your computer. Now snap a picture with your mobile phone and rename it to...
 
automation toolsleep moon xpress softwaresleep moon xpress reohixreohix sleep moon xpressremote launchremote turn offremote control computerauto shutdown computer
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...menu previewing, 2000+ special effects, Photoshop plugin support, picture index creation, slideshow capabilities, 3D text and shapes,...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer