1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...integration into Windows applications. A special attention is paid to provide responsive user interface while maintaining maximum...
 
sharingprivatelibrariessecurefile
BeListings Free eBay Software

Freeware by Sysworkers LLC
30 x 2Kb downloads

...description, search PayPal sellers or just in titles. Read the complete help in order to create most...search, consist in creating a relevant searchable content. Paid Search, consist purchasing the correct keywords on a...
 
ebay listing softwarefree ebay software
Books Program

Shareware by CyberNiche Software
19 x 4893Kb downloads

...they are, who wrote them, whether you have read them or loaned them, and how much you...
 
reference resourcerare bookslibraryliteraturereadingbook collectorscience fictiontitleshorrorlibrariesbookshelvesbibliographyorganizecook booksauthorsbibliophilebook collection
...integration into Windows applications. A special attention is paid to provide responsive user interface while maintaining maximum...
 
privatesharingsecureclientserverfile
...as e-mail message text and ensure they get read and paid. • auto-invoicing: automate your regular billing...
 
business softwarevat invoicecashbookinventoryinventory softwareinvoicing softwarehst invoicegst invoiceaccounting softwaree-mail invoicesmake invoicepst invoiceinvoice softwaresmall businesshome business
Ancient Casttle 3D Photo Screensaver

Shareware by Photo Screensavers
16 x 12702Kb downloads

...Yes, this is one of the castles you read in one very popular fantasy book. Try to...river, even a waterfall! Special attention has been paid to the interior of the castle and the...
 
castlephoto screensaverancient castle screensaver
AutoBlog

Shareware by Trustedarticles
19 x 317Kb downloads

...extremely valuable time, so we want you to read on. We know how it is, you have...blog posting software there is no need to read extensive manuals, watch boring tutorials or pay to...
 
link exchangelink buildingblog softwareposting softwareautomated blog postingcomment postingrss blog
PTR-Buster

Shareware by Stonito Software
23 x 2587Kb downloads

...What PTR has to offer you? - Automatic reading of all e-mail accounts (POP3) - Automatic reading...process - Organizing of received mails for easy reading and management - Remembers all your decision, doesn`t...
 
ptr-busterauto clickcheat botpaid2readpaid read
Who Owes Who What?

Shareware by Loginetics, Inc.
24 x 340Kb downloads

...debts and shows them in an easy to read textbox. This removes the difficult task of trying...to find old bill stubs and remember who paid them and sum up each individuals debt each...
 
bill splittercost sharingbill trackinggroup expensesshare expensesliving expenseswho owesexpense sharingexpenseit
...Are the community sites like Craigslist, Backpage, Kijiji too restrictive and lack effectiveness in getting your word out? Are you looking for a NEW, LESS RESTRICTIVE, EXCITING and EFFICIENT way...
 
questionscommunitynewssaleglobal p2peventsservicespeer-to-peer networkarticle publishingannouncementsproductswantedemploymentbulletinworldwide advertising
Get Paid Script

Freeware by AdiKit, Inc.
13 x 4653Kb downloads

...AdiKit Get Paid Script: If you want to create and manage...from a simple get paid to click, get paid to read e-mail or get paid to surf...to a professionally structured affiliate program, AdiKit Get Paid Script™ script is the tool you are looking...for your program. Be professional. Be a Get Paid ™ user! Paid to Read Paid to Click...
 
paid readpaid salescript get paidpaid leadpaid signuppaid promotepaid clickpaid play games
...Qixit (pronounced "kicks-it") is more than just great free software. It literally pays you to use it! First, Qixit is a proprietary email service with unparalleled security. Messages to...
 
bill paymentsprivate emailget paid readfeature rich emailencrypted emailemail clientproprietary email accountprivacy controlmore secure emailfund transactionsmicropaymentspaymailinvoiceextra functionsencryption
Ancient Castle 3D Screensaver

Shareware by 3Planesoft
28 x 15901Kb downloads

...Yes, this is one of the castles you read in one very popular fantasy book. Try to...river, even a waterfall! Special attention has been paid to the interior of the castle and the...
 
fantasybattlescreensavercastlenature
Net Get Paid PlusKit Script

Freeware by Pluskit, Net.
13 x 4653Kb downloads

...nET Get Paid PlusKit Script: If you want to create and...manage from a simple get paid to click, get paid to read e-mail or...get paid to surf site to a professionally structured affiliate...program, Get Paid Plus™ script is the tool you are looking...for your program. Be professional. Be a Get Paid Plus user! Get Paid Plus Script Requirements PHP...
 
paid salepaid play gamespaid readpaid clickpaid leadscript get paidpaid promotepaid signup
Air TV for iPhone/iPod Touch (Windows Version)

Commercial by Senstic
12 x 16994Kb downloads

...your tuner can receive from you home. You`ve paid for your cable programs, and now you get...that impose a number of system requirements. Please read them carefully. Requirements * iPhone 3G or iPod...
 
ipodtelevisionremotevieweriphone
Get Paid Script

Shareware by NetTrekk, Inc.
5 x 1Kb downloads

...Get Paid Script - Run your own get paid to click, promote, sell, signup, play games and...read email.Get Paid Script: If you want to create and manage...from a simple get paid to click, get paid to read e-mail or get paid to surf...site to a professionally structured affiliate program, Get Paid script is the tool you are looking for....
 
paid signuppaid clickscript get paidpaid play gamespaid promotepaid leadpaid readpaid sale
Autosurf_Traffic_Exchange

Shareware by ProKt
3 x 1Kb downloads

...Unique traffic exchange scripts and software, get paid to surf, read, click, refer and promote scripts....your answer, start your own traffic exchange or paid to read site TODAY! Web hosting and domain...own service scripts traffic exchange, traffic systems and paid to read email scripts. These scripts allow you...to run your own traffic exchange service or paid to read/click site.Paid to auto surf - member...
 
dedicated serversdomain namescgitraffic exchange softwareearn monetraffic exchange scriptget paid surftraffic exchange systemclickreadscriptsperlphpscriptingweb hostingregistrysemi-dedicated hosting
WordPress Membership Site

Freeware by 3 Apps
2 x 44974Kb downloads

...How To Turn a WordPress Blog into a Paid Members Site that Sells Itself In Less Than...like. You can limit parts to free members, paid members, etc. Let visitors read some of your...
 
free membership sitescreate membership websitecreating membership siteshow membershcreate membership site
File List Generator

Freeware by ReStoring Data Inc.
1 x 5766Kb downloads

...ReStoring Data’s File List Generator Freeware software filters, prints, and organizes via a file’s: name, type, size, created date, and date last modified. It was developed by the...
 
data recovery tooldata recovery file listfile list generatorhard drive listfile list recoveryfile list viewerrestoring data file listfree file listfolder listdata recover service
HotSpot Software. Wifi Billing System

Freeware by Microsolut
3 x 108122Kb downloads

...Microsolut HotSpot Manager.Create your free or paid HotSpot service.Quick and easy setup. Windows-Windows based software...solution for HotSpot billing and HotSpot management, just read below.You can set the validity time period, bandwidth...
 
hotspot softwarebandwithmanagerbillingwifi