1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
GameNet Browser

Freeware by Solarbaybies, Inc
44 x 6020Kb downloads

...and complete privacy, deletes any track history and cache when you leave the machine alone or to...In addition with GN you can send web page previews and links to friends with one click....the GN sidebar shows thumbnails of the web pages and their loading progress, use the thumbnails to...
 
internet explorerpop-upfunbrowseravant browsergamerstabbedgamesgaming
ETagFix

Freeware by ISAPILabs
30 x 713Kb downloads

...to check against to see if a web page has changed. ETagFix fixes the problem where etags...for each page change once your machine is rebooted which if...crawlers crawling your web site when your web page has not changed at all. ETagFix saves you...user browsers when the content of your web pages has actually truely changed....
 
http headersiisrestartetagcacheisapiserverexpiredrebootpage
Menu Builder OS

Freeware by ArtistScope
33 x 74Kb downloads

...problems found with using JavaScripts for rollovers in page inserts. Menus need to be fast loading, retrievable...from cache, and workable with page inserts. From the publishing point of view they...need to be able to be placed into pages efficiently. Menu Builder enjoys the same rollover functions...to how many can be used on a page or the variations possible. On MouseOver it displays...
 
linkappletimagenavigaterollovermenusoundswapbutton
Cache View Plus

Shareware by ANKONiT Software
10 x 2026Kb downloads

...pictures and other files from the web browser cache with categorized review list. The intuitive Windows interface...makes Cache View Plus fast to learn and easy to...use. Cache View Plus has convenient features to view recent...(Hot) items. Simply start Cache View Plus, visit an interested web page, press...Load Cache button in Cache View Plus and get highlighted hot items from...this web page to view and extract.
 
browsercachewebviewviewerfileinternetsavemozillaexplorerfirefox
...it remembers everything you see, automatically adding new pages to the cache. WebAssistant updates your cached pages...can even use your bookmarks or search your pages offline when you don`t have a network connection....access. You can sure you`ll always have the page you need with MM3-WebAssistant. Mobile users have the...you really need. Important Features: Automatically archive all pages visited.
 
cache archivefreewareweb site collectionoffline browserjavaweb browsing toolsbookmarkoffline browsingnavigationknowledge managementoff-line readersurfdownload web sitesinternet
GGSearch: The search tool with Google™ power!

Freeware by P.J.Kraaima
22 x 982Kb downloads

...Google™ Mode. Don`t forget tp change your Google™ page output. The tool can you keep: always on...
 
ggsearchggzoeksearchtoolkraaima
Menu Builder

Freeware by ArtistScope
22 x 91Kb downloads

...problems found with using JavaScripts for rollovers in page inserts. Menus need to be fast loading, retrievable...from cache, and workable with page inserts. From the publishing point of view they...need to be able to be placed into pages efficiently. Menu Builder enjoys the same rollover functions...to how many can be used on a page or the variations possible. On MouseOver it displays...
 
menulinkswapimagerolloverappletbuttonsoundnavigate
Ki-Washer

Freeware by Kalavath Infotech
41 x 146Kb downloads

...the internet, Internet Explorer stores information about every page that you have visited on to your computer....
 
safetemp files removertemp cleanerhistorycookiesprivatebrowser cache removersecurefree windows cleanerdelete temporary fileseraseinternet cleaner
...The IE cache contains a kind of travel record of the...Internet Files folder. Storing these files in your cache can make browsing the Web faster because it...your computer less time to display a Web page when it can call up some of the...page`s elements or even the entire page from your local Temporary Internet Files folder. A...full browser cache can slow down your surfing experience. When the...
 
privacytrackinternethistorycleanurlvisitedcache
Gogo Explorer

Freeware by Gogosoft
22 x 1749Kb downloads

...1. Minimum memory usage(set memory option first). 2. Cache manager: smaller flow of the network, faster speed....with middle button of mouse. 4. Design web page before print. 5. Net TV. 6. Download tool....page. 17. Resume last visited pages. 18. Resume pages broken by error. 19. View medias within Gogo...Explorer. 20. Clean privacy data. 21. Save web page as picture 22. Domain completion 23. Zoom web...
 
tabbed browsergogo explorerweb browserdownload toolhigh speed
GetBot

Freeware by GetBot
35 x 321Kb downloads

Free Vista Files award
...and Flash animations that play automatically on a page can`t be downloaded with a browser. GetBot can...
 
resumeparsedragcrawlwindowsloopwebleacherextractinternetsnatchrecoverprogramdialcollectblockscourmp3accelerategetbotleecherget botrippumpsearchhttpfixboostsoftwarestripscheduledefeatftp
Gigaget

Freeware by Giganology
219 x 2052Kb downloads

...page) to download Advanced Intelligent Functions Intelligent Disk Cache system which protects your hard disk from high-speed...
 
download tooldownload clientdownload managet
ABF Internet Explorer Tools

Shareware by ABF software, Inc.
20 x 1094Kb downloads

Free Vista Files award
...Explorer browser. The software contains a tool bar, page browser, magnifier bar, and a set of additional...block annoying popup windows or refresh any web page ignoring browser cache; people with poor eyesight will...very helpful; professionals will be able to refresh page or images by one click, save all images...
 
toolsblockabfexplorermagnifiermagnifyimagessavewindowsinternetrefreshbrowserutilitespop-ups
Absolute Database

Shareware by ComponentAce LTD
20 x 34799Kb downloads

Free Vista Files award
...into EXE; Single-file database format; High Speed; Advanced cache management and buffering architecture; Sophisticated SQL query and...units; Small database file size achieved by customizable page size, compression of table metadata and other special...
 
single file databasedatabase delphibde replacementdelphi databasedatabase componentbde alternative
History Search

Shareware by eTopping Software
14 x 900Kb downloads

...search engine but it can search only the pages stored in the browser`s cache. The search time...depends on the cache size, intensity of work in the Internet and...the link and you will get the required page opened (the local copy or the original one...
 
searchbrowser cachehistory searchbrowser search
Mil Shield

Shareware by Mil Incorporated
36 x 4300Kb downloads

Free Vista Files award
...from features that are good and convenient: Internet cache speeds up the browsing, cookies protect you from...and over again, etc. Mil Shield selectively preserves cached files, history and/or cookies for chosen by you...level, Windows temporary files, and restores your home page if it is hijacked. NEW: Supports Chrome 35,...
 
securityhistorymrudeletemost recently usedindexdathome pageuserdata recordsinternet explorerstart pagecookiesprivacyfirefoxcleansafarioperatyped url historycacheevidencerecent documentsremovetrackserase
CleanMantra

Shareware by PCMantra
24 x 656Kb downloads

...trouble free browsing by preventing IE Browser Home Page Hijacking. Full Proof Scheduling of CleanMantra, even if...any ones work or time. All the web pages you view, music you listen to, emails you...include History files, auto complete form data, Internet Cache Files, Cookies, Visited URLs, downloaded Program Files, Recycle...
 
window washernsadodcookie cleanershredhard disc cleanerbrowser hijackprivacyhijackthishome page hijackcookie washerinternet cleanerwindow cleanerinternet washerdelete history filesactive protection shield
27 Tools-in-1 Wichio Browser

Shareware by Revopoint Co., Ltd.
18 x 6685Kb downloads

...URL Alias, Open All Links in the Current Page and more....
 
reminderflashtranslateprivatehistorye-mailresourcelyricnetstatdictionarycookiesscreenupdatespeechfillerrefreshtraceroutewhoismapdnsvoicecurrencycacheblockalertcaptureweather
httpZip

Demo by Port80 Software
29 x 2216Kb downloads

...significantly REDUCES BAMDWIDTH costs. More importantly, it improves page load times for your site`s visitors, leverages your...the developer or admin to GRANULARLY compress Web pages using HTTP encoding algorithms supported in all modern...browsers to reduce page file sizes to as little as 2% of...(HTML, CSS, JavaScript, or any text-based file), dynamic pages (including ASP, ASP.NET, ColdFusion, PHP, Perl, and JSP...
 
speedpdfhtmlaspaccelerationhttpzippage performanceinternet information servicesjava scriptgzipweb serverhttp zipcontent encodingoptimizationcssmicrosofthttp compressioniisreduce bandwidthslow bottleneck
MyProxy

Shareware by DeSofto
25 x 892Kb downloads

...quality web accelerator with powerful ad blocker and cache will save your time, money and nerves. MyProxy...URL for finding an Internet resource * Web page loading time optimization (data transfer volume reduction) MyProxy`s...
 
cachestatisticssmtphttpsblockingpop3portmapsharingproxyspeedupsharebanners