1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...RSS feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a...functionality from anywhere using a standard web browser.The Outlook Connector provides real-time, two-way synchronization of mail, contacts,...tasks, calendar events, notes and journal items between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...reminder by phone from Microsoft Outlook. A FREE Outlook addin that takes advantage the telephony capabilities of...version available. The alert pop up window from Outlook is useless if you are not in front...computer. This program solves the problem by enabling Outlook to call your cell phone or any phone...is an addin, the program automatically starts when Outlook starts, and terminates when Outlook terminates. OutlookReminder adds...
 
outlook addintelephone remindertelephonyfreewareappointment remindersphone remindersoutlook reminder phone
OsaSync Lite

Freeware by Vaita
17 x 2963Kb downloads

...With OsaSync Lite you can share and/or synchronize Microsoft Outlook contacts on your local...Use OsaSync Lite when you want to: a} Share some common contacts in your contacts folder with...your family members. b) Synchronize your Outlook folders on your laptop with your desktop. c)...Save your customers in a COMMON CONTACTS FOLDER Share you Outlook contacts with one, two or three...your network.
 
cell phonesynchronizationsynchronizeoutlookshareemailcontactspdacollaboratesharingnet folderscollaborationpalm
GroupWare

Demo by Alt-N Technologies, Ltd.
16 x 1946Kb downloads

...MDaemon GroupWare unlocks the collaborative functions of Microsoft Outlook using MDaemon as the mail server platform. Outlook...users can share Calendar, Tasks, Contacts, Notes, and Journal folders without...the permissions of which folder(s) they wish to share with other users, WorldClient (MDaemon`s web-based email client)...will allow you to see items in your Outlook calendar from anywhere, and GroupWare licensing is independent...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
MAPILab NNTP for Outlook

Shareware by MAPILab Ltd.
61 x 5191Kb downloads

Free Vista Files award
...read and post messages to newsgroups from Microsoft Outlook 2000, 2002/XP, 2003 and 2007. This product is...through the common Send/Receive menu. MAPILab NNTP for Outlook supports all messages formats (plain text, RTF, HTML)...Microsoft Exchange Server and can be used to share newsgroups for coworkers through public folders....
 
outlook softwarenntp serveroutlook 2003addinnewsgroupsusenetmicrosoft office 2007news serveraddonplugin
QSearchFolders

Shareware by Quester
19 x 1017Kb downloads

...existing search folders in all versions of MS Outlook and in each place in an Outlook tree....It makes the automatic scanning of Outlook folder such as email and contacts, tasks, calendars...way to gather email messages and other Microsoft Outlook items into a folder based on your search...their locations. One of the new features of Outlook 2003 are search folders, once created the for...
 
share foldersoutlook shared filespersonal folderssharing pstoutlook folder managementshare outlookoutlook teamoutlook groupwareoutlook sharingoutlook search folderoutllook folder listsearch folders
PasswordNow Outlook Recovery Tool

Demo by LastBit Software
20 x 63Kb downloads

...the Express Recovery service. If you protected your Outlook personal folder (.pst file) with a password and...one recovery session. Besides, you don`t have to share the document with other people. Key features: -...
 
passwordforgottenbreaklostrecover
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
18 x 3009Kb downloads

Free Vista Files award
...is designed to solve two tasks - synchronizing Outlook folders on several computers and organizing shared access...to Microsoft Outlook folders for small companies. The product supports all...types of Microsoft Outlook folders and items - email messages, contacts, notes,...folders and items that don`t belong to Microsoft Outlook and which are attached with the help of...Server.
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
...personal address book and appointment calendar. Existing MS Outlook or Outlook Express contacts can be imported easily...features allow multiple users inside the domain to share contacts and appointments. Received messages can be clearly...
 
calendarisapigroupwarewebmailsmtppop3email
Outlook Profiler

Commercial by GOFF Concepts
20 x 2200Kb downloads

...This program addresses the need to setup Outlook Exchange profiles automatically. Outlook 97 through 2013 versions...Possibly one of the best ways to use Outlook Profiler in the corporate environment would be to...place Outlook Profiler inside a public share. Then you could...execute Outlook Profiler from the "run" line, or create a...the executable.
 
automaticallyexchangeprofilescreate
WebAsyst Address Book

Shareware by WebAsyst, LLC
18 x 2441Kb downloads

...you to organize contact entries into folders and share access with your team. Enhanced navigation and usability....Results list. Import/Export your address book from/to MS Outlook Express, The Bat or custom .CSV file. When...
 
web based contact managementonline address book softwareonline contact managementcontact management softwareweb based address book
Active Desktop Calendar

Shareware by XemiComputers Ltd.
99 x 5627Kb downloads

Free Vista Files award
...organize your data in color coded layers and share them with other people on a local area...network. The program can integrate with Outlook to show its appointments and tasks on the...
 
recurring appointmentswallpaperpersonal information managerorganizertasksschedulerprintdata sharingxemicomputersalarmsactive desktop calendaraddress booknotespimcontactsrecurrencelanicons
ShareCalendar for Outlook

Shareware by 4Team Corporation
170 x 8153Kb downloads

Free Vista Files award
...Share and synchronize Outlook calendar on multiple PCs without Exchange server. ShareCalendar...is a Microsoft Outlook add-in for sharing and synchronizing Outlook calendar folders....sync meetings in a few clicks. Synchronize and share outlook calendar items automatically or manually. Share different...of your family or coworkers. Synchronize your PCs Outlook calendar information between your desktop, laptop, netbook and...
 
appointmentsync outlook calendarshare calendarcalendar itemsynchronize outlook calendarmeetingoutlook calendar syncsync calendarshare outlook calendarsync calendar outlook
GroupCalendar

Demo by OpusFlow
20 x 4782Kb downloads

Free Vista Files award
...with Outlook. GroupCalendar is an easy to install Outlook add-on, which solves that problem effectively and flexibly....
 
groupdiarysharecalendaroutlookschedule
MyLifeOrganized

Shareware by mylifeorganized.net
41 x 5277Kb downloads

Free Vista Files award
...multiple computers at home and the office and share a single task list or collaborate with other...actively developed, so join the MLO community and share your ideas: http://groups.google.com/group /MyLifeOrganized http://facebook.com/MyLifeOrga nized...
 
priorityoutlook synctask managementactivityto-do list managertask trackingtodopimtree-structuredcheck-listlife goalsmindmanagercalendartime managementorganizeroutlinerpersonal project tracking
ShareO for Outlook

Shareware by 4Team Corporation
17 x 8106Kb downloads

Free Vista Files award
...Synchronize and share Outlook folders on multiple PCs without a server. Microsoft...Outlook add-in for synchronizing and sharing Outlook folders, sharing PST, sharing e-mail, sharing calendar, tasks,...notes and journal items without Exchange server. Share Microsoft Outlook Public or Personal folders, Windows documents...with your collegues, family and friends easily.
 
share contactssync outlooksharing outlookshare outlook contactssharing emailsharing pstoutlook syncshare outlook calendarsharing outlook calendarshare calendaroutlook sharingoutlook sharesynchronize outlook
edocXL

Shareware by BSI SA
20 x 90600Kb downloads

...into text searchable PDF files which you can share online. * Convert any PDF file to Word,...
 
pdf supportbusiness card scanningpdf createbusiness card recognitionpaperless officeocrpdf convertdocument scanningfull text retrieval softwaredocument managementimage management
ShareContacts for Outlook

Shareware by 4Team Corporation
24 x 8170Kb downloads

Free Vista Files award
...Share and sync Outlook contacts on multiple PCs without Exchange server. ShareContacts...is a Microsoft Outlook add-in for synchronizing and sharing Outlook contacts. Sync...distribution lists in a few clicks. Synchronize and share Outlook contacts automatically or manually. Share different contact...coworkers, teammates, friends or family. Synchronize your PCs Outlook contact information between your desktop, laptop, netbook and.
 
outlookcontactssync outlook contactsshare contactssharing outlook contactssync address bookoutlook sync contactsoutlook sharing contactscontacts outlooksynchronize outlook contacts
OLTaskSync

Shareware by Somebytes
20 x 465Kb downloads

...and use this application you only need your Outlook to be configured with an e-mail account (POP3)....OLTaskSync is very convenient to: - Use your Outlook Tasks from home as well as at the...folder on your laptop with your desktop. - Share tasks with other club/association members - Check tasks...road. - Mark tasks for mobile colleagues. - Outlook net folder alternative (net folders from OL2000)....
 
taskexchangesynchronizingoutlookadd-inol2002ol2003
Outlook TeamContacts

Shareware by OpusFlow
15 x 422851Kb downloads

...contacts in one global address list integrated with Outlook is a challange. TeamContacts is an easy to...install Outlook add-on, which solves that problem effectively and flexibly....Share your Outlook Contacts! - No Exchange Server required; - Filter...the address cards you want to share with categories; - PDA is supported; - Uses...a shared database, no email connectivity required...
 
contactsteamoutlookglobal address listgroupwareadd-ondatabase