Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...functionality from anywhere using a standard web browser.The Outlook Connector provides real-time, two-way synchronization of mail, contacts,...tasks, calendar events, notes and journal items between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by SMSCOUNTRY
397 x 2744Kb downloads

...You can send sms from Microsoft® Outlook® and it is as simple as sending an email. Keep in touch with customers, staff or colleagues with this SMS add-in for...
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
...Trivial Proxy is a small application that allow to see and log network activity of the any applications(browsers, email clients etc.). So what does that mean in English? Simple,...
Advanced SMTP Server

Shareware by IM-Soft
590 x 14208Kb downloads

Free Vista Files award
...Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The email program you...
RapidSMTP Free Edition

Freeware by
72 x 10904Kb downloads

Free Vista Files award
...RapidSMTP is an award winning high-performance e-mail marketing software to create and send personalized marketing e-mails. Send e-mails at any speed your project or company requires....
Random Signature Changer

Freeware by den fete gjengen
65 x 230Kb downloads

...RSC helps you change your mail signature. All you have to do is set up one or several signature database files containing the text you want to use as your...

Freeware by Comodo Inc
93 x 10370Kb downloads

...Comodo AntiSpam Desktop 2005 is an intuitive, easy-to-use, client-based software product that eliminates spam forever from the computer`s email system. No license fees - No charges - No...
free antispam toolfree antispam softwaredesktop antispam toolantispam free download
M8 Free Multi Clipboard

Freeware by M8 Software(UK)
106 x 7006Kb downloads

...CLIPS - M8 is the simplest of all multi-clipboard and screen capture programs. Just have it running minimized and it captures everything you cut or copy from other programs. It...
multiclipboardscreen capturemulti-clipboardscreenshotscreen shotmulti clipboard
Cactus Spam Filter

Freeware by Codeode
112 x 634Kb downloads

...tested with these e-mail clients: Microsoft Outlook, Microsoft Outlook Express, Netscape, Opera, Mozilla, Mozilla Thunderbird, Eudora, Pegasus...
PC SMS - Outlook SMS

Freeware by
472 x 5273Kb downloads

...SMS directly from your PC, Outlook or Outlook Express to any GSM compatible phone. Key Features:...- integration with Outlook or Express addressbook - send to mulitple recipients...service please mail Full Integration with MS Outlook and MS Outlook Express. Message status information through...simple web interface. Perfect integration into the MS Outlook and Outlook Express look and feel. Encompassing help...
windows 2000internationalexpresssmswinxpsimstext messagessend smscomputerwindows 2003text messagingemail-smsdesktopvia outlookcomunifiedwin2kinternet
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...Free SMTP Server supports all email programs like Outlook Express and Eudora, but best optimized to work...with Outlook Express. The email program you already use for...
.::Anonymous Guest - Proxy Checker, SOCKS Manager::.

Freeware by SPS-Group
149 x 7034Kb downloads

...working speed. Supports interaction with Internet Explorer, Opera, Outlook Express, ICQ and other popular programs....
Shark Email Extractor

Freeware by
249 x 440Kb downloads

...your local hard disk drive to Network, MS Outlook Express, MS Outlook, MS Exchange, Netscape Messenger, Eudora,...
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber

Freeware by, Inc.
54 x 121Kb downloads

...losing touch with people? Add features to Outlook or Outlook Express and Keep in Touch automatically....
contact updateroutlook plugincontact managementreunionkeep touchoutlook expresspeople searchautomatic updategoodcontactsupdate contacts
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
114 x 29442Kb downloads

...TheSage`s English Dictionary and Thesaurus is a one-click complete dictionary and multifaceted thesaurus of the English language. TheSage can look up words directly from almost any program (IE,...
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
Acubix PicoBackup for Outlook Express

Freeware by Acubix
66 x 3453Kb downloads

...PicoBackup Outlook Express Edition is an easy-to-use Outlook Express emails backup utility packed with many powerful...

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...for you! SpamAware is a plugin for MS-Outlook, Outlook Express and Windows Mail (Vista). It uses SpamAssassin...and is able to automatically add all your Outlook contacts and add recipients of mails you write...
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
EssentialPIM Portable

Freeware by Astonsoft Ltd.
144 x 13083Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities and versatile print features. EssentialPIM...
personal organizeroutlinernotes keeperpimfree pimpersonal pimpersonal information managercontacts keeperschedulerdayplannercontact managerdaily organizer

Freeware by Astonsoft Ltd.
125 x 11243Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities, versatile print features, and adjustable...
contact managerschedulerdayplannerpimoutlinerpersonal information managercontacts keeperpersonal pimpersonal organizerfree pimdaily organizernotes keeper
SPAMfighter Standard

Freeware by SPAMfighter
451 x 2529Kb downloads

Free Vista Files award
...stand alone, anti-spam and anti-phishing tool for Outlook, Outlook Express, Windows Mail, Windows Live Mail or Thunderbird....
microsoftthunderbirdjunkantispameatermailfilterantipuboutlookfreeanti-pubphishingblockerspamkillerspam filterfreewarejunkmailspammersspammingexpressmozilladownloads