Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...functionality from anywhere using a standard web browser.The Outlook Connector provides real-time, two-way synchronization of mail, contacts,...tasks, calendar events, notes and journal items between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
SMSCOUNTRY SMS Mail Box

Freeware by SMSCOUNTRY
234 x 2744Kb downloads

...You can send sms from Microsoft® Outlook® and it is as simple as sending an email. Keep in touch with customers, staff or colleagues with this SMS add-in for...
 
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
...Trivial Proxy is a small application that allow to see and log network activity of the any applications(browsers, email clients etc.). So what does that mean in English? Simple,...
 
proxylogtunnel
Advanced SMTP Server

Shareware by IM-Soft
381 x 14208Kb downloads

Free Vista Files award
...Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The email program you...
 
freemailsmtpmailermassbomberemaile-mailbulkbookmailingremaileraddress
RapidSMTP Free Edition

Freeware by RapidSMTP.com
63 x 9008Kb downloads

Free Vista Files award
...RapidSMTP is an award winning high-performance e-mail marketing software to create and send personalized marketing e-mails. Send e-mails at any speed your project or company requires....
 
mailinglistmarketingemailemailsbulknewslettergeolocationsqlsendmysqlnewsletters
Random Signature Changer

Freeware by den fete gjengen
53 x 230Kb downloads

...RSC helps you change your mail signature. All you have to do is set up one or several signature database files containing the text you want to use as your...
 
expresse-mailclientwinampoperaoutlookthunderbirdemailsignature

Freeware by Comodo Inc
77 x 10370Kb downloads

...Comodo AntiSpam Desktop 2005 is an intuitive, easy-to-use, client-based software product that eliminates spam forever from the computer`s email system. No license fees - No charges - No...
 
free antispam toolfree antispam softwaredesktop antispam toolantispam free download
M8 Free Multi Clipboard

Freeware by M8 Software(UK)
92 x 4834Kb downloads

...CLIPS - M8 is the simplest of all multi-clipboard and screen capture programs. Just have it running minimized and it captures everything you cut or copy from other programs. It...
 
multi clipboardscreen capturescreenshotscreen shotmulticlipboardmulti-clipboard
Cactus Spam Filter

Freeware by Codeode
95 x 634Kb downloads

...tested with these e-mail clients: Microsoft Outlook, Microsoft Outlook Express, Netscape, Opera, Mozilla, Mozilla Thunderbird, Eudora, Pegasus...
 
filtercactuspegasusbayesianmozillaspamoperafreeincredimailexpressnetscapeoutlookthunderbird
PC SMS - Outlook SMS

Freeware by ComUnified.com
322 x 5273Kb downloads

...SMS directly from your PC, Outlook or Outlook Express to any GSM compatible phone. Key Features:...- integration with Outlook or Express addressbook - send to mulitple recipients...service please mail support@comunified.com Full Integration with MS Outlook and MS Outlook Express. Message status information through...simple web interface. Perfect integration into the MS Outlook and Outlook Express look and feel. Encompassing help...
 
windows 2000internationalexpresssmswinxpsimstext messagessend smscomputerwindows 2003text messagingemail-smsdesktopvia outlookcomunifiedwin2kinternet
Free SMTP Server

Freeware by IM-Soft
293 x 619Kb downloads

Free Vista Files award
...Free SMTP Server supports all email programs like Outlook Express and Eudora, but best optimized to work...with Outlook Express. The email program you already use for...
 
mailingmailerremailerbomberaddressbulksmtpfreebookmasse-mail
.::Anonymous Guest - Proxy Checker, SOCKS Manager::.

Freeware by SPS-Group
138 x 7034Kb downloads

...working speed. Supports interaction with Internet Explorer, Opera, Outlook Express, ICQ and other popular programs....
 
serverchaintestcheckertoollistprivacymanagerproxyinternethttpsoftwareanonymityconnectprotectionsocks4firewallanonymizerhttpssecuritysocks5
Shark Email Extractor

Freeware by Logambo.com
235 x 440Kb downloads

...your local hard disk drive to Network, MS Outlook Express, MS Outlook, MS Exchange, Netscape Messenger, Eudora,...
 
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber

Freeware by Reunion.com, Inc.
43 x 121Kb downloads

...losing touch with people? Add Reunion.com features to Outlook or Outlook Express and Keep in Touch automatically....
 
contact updateroutlook plugincontact managementreunionkeep touchoutlook expresspeople searchautomatic updategoodcontactsupdate contacts
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
99 x 21442Kb downloads

...TheSage`s English Dictionary and Thesaurus is a one-click complete dictionary and multifaceted thesaurus of the English language. TheSage can look up words directly from almost any program (IE,...
 
thesageone-clickdictionarywildcard searchconcordancerspeechpronunciationlookupenglishthesaurusword listsanagram
Acubix PicoBackup for Outlook Express

Freeware by Acubix
56 x 3453Kb downloads

...PicoBackup Outlook Express Edition is an easy-to-use Outlook Express emails backup utility packed with many powerful...
 
restoreaesblowfishsecuritycompressbackupburningencryptionemailoutlookdecompressdvdftpexpresszip
SpamAware

Freeware by JAM Software GmbH
46 x 14619Kb downloads

Free Vista Files award
...for you! SpamAware is a plugin for MS-Outlook, Outlook Express and Windows Mail (Vista). It uses SpamAssassin...and is able to automatically add all your Outlook contacts and add recipients of mails you write...
 
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
EssentialPIM Portable

Freeware by Astonsoft Ltd.
126 x 9571Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities and versatile print features. EssentialPIM...
 
dayplannerpersonal information managercontact managerfree pimpersonal pimoutlinerdaily organizernotes keeperschedulercontacts keeperpersonal organizer
EssentialPIM

Freeware by Astonsoft Ltd.
109 x 7909Kb downloads

Free Vista Files award
...entries and contacts. Offers AES 256-bit encryption, MS Outlook import/export, search capabilities, versatile print features, and adjustable...
 
outlinerdaily organizerdayplannercontact managerpersonal information managerpimnotes keepercontacts keeperfree pimpersonal organizerpersonal pimscheduler
SPAMfighter Standard

Freeware by SPAMfighter
244 x 2525Kb downloads

Free Vista Files award
...stand alone, anti-spam and anti-phishing tool for Outlook, Outlook Express, Windows Mail, Windows Live Mail or Thunderbird....
 
spamjunkmailspammersfiltereaterfreewarespamminganti-pubantispamjunkmailspamkillerthunderbirdmozilladownloadsoutlookantipubexpressmicrosoftblockerphishingspam filter