1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Oracle Security Check

Freeware by eNSYNC Solutions
20 x 400Kb downloads

...Oracle Security Check will connect to your database and test against an internal list of standard...
 
oracledatabaseanalysissecurity
dbQwikSite Personal Plus Edition

Freeware by Gerald Enright
19 x 13452Kb downloads

...dbQwikSite PE :Free Database Web Site Builder Software Personal Edition is a...no coding required. Highlight Features: -Generates complete interactive database web sites with no coding -Generates both ASP...either Unix or Windows -Works with most popular databases such as: MS SQL, MS Access, Oracle, DB2...with data validation -Integrated web publishing support -Integrated database management tools -Database "Up Sizing" and "Down Sizing"...
 
freeware
VeriFinger Extended SDK Trial

Demo by Neurotechnology
19 x 520040Kb downloads

...and other network-based systems. The server-side software includes database support modules for MySQL, PostgreSQL, SQLite, Microsoft SQL...Server and Oracle databases. The SDK is based on a reliable...
 
biometricallinuxauthenticationsecuritymatchingfingerprintsdkrecognitionverificationidentificationaccess controlscanwindowsmaclogonattendance control
COM Express for .NET

Commercial by Shoutsoft, Inc.
16 x 3128Kb downloads

...Express for .NET is the most powerful C#/VB.NET database code generator you can find, it generated the...
 
n-tiernet code generatorcsharp code generatorvbnet code generatordotnetnukeclsanet3-tier
...Blue Ink retrieves meta-data from SQL Server or Oracle and asks the user high level, customizable questions...Blue Ink may be used for free with database that contain 15 or fewer tables (e.g. Northwind)....
 
net generatorsoftware development tooldatabase utilitycode generatorrapid application developmentcode generationweb development tooldatabase developmentcase tool
CodeCharge Studio

Shareware by YesSoftware, Inc.
16 x 31812Kb downloads

Free Vista Files award
...visual Web Reporting. Developers can quickly convert any database into a Web application by using the included...interface, developers can connect to any number of databases and utilize a variety of forms and templates...Netscape Enterprise Server, etc. that connect to relational databases that include Microsoft Access, MS SQL, mySQL, Oracle,...
 
vbnetpostgresqljspfoxprojavaoraclemysqlphpwebperlaspinternetreportingdatabaseaccesscoldfusion
Free Vista Files award
...dialects. In many cases, direct connection to the database is undesirable or even impossible from the point...of view of security or performance, for example in the ASP.NET environment....
 
activexcontrolsqlbuildervisualquery
ArchiDoc

Shareware by Canteco
12 x 3991Kb downloads

...Desktop XML version of the complete ORACLE based document management system, that gives any size...Language interface;Auditing and reporting. As well as (for Oracle product line) Instant back-up; Internet-type access...
 
edocustordocument management softwarearchidoc softwaredocument management systempaperless office softwaredocument archiving softwarecantecoxml databasesecurity
CGIScripter

Demo by .com Solutions Inc.
13 x 1471Kb downloads

...Server, Sybase, DB2, PostgreSQL, FrontBase and FileMaker 7 database servers. Feature include: -- Dramatically improves developer productivity...-- Improve security of web applications -- Save thousands in infrastructure...via the web with ease -- Utilizes web security best practices for Perl CGI programming -- Automated...
 
postgresqlmysqlfrontbaseperl scriptdb2accessapacheperl cgidatabasesql serveroraclesybase
Guggi for Oracle

Shareware by Impact Solutions
10 x 9306Kb downloads

...Administration, PL/SQL programming and data analysis tool for Oracle 8.0, 8i, 9i and 10g. Are Browse the...trigger, sequence, schema, tablespace, procedure, package, materialized view, database link, type, rollback segment, directory, operator, library, queue,...summary, external tables; Tab through the properties of database objects; Several Developer and DBA features backup statistics,...
 
analysisdatabase developmentdbadatabase tooloracleplsqlanalystsdevelopersprogrammingadministration
Installgen

Commercial by .com Solutions Inc.
12 x 2296Kb downloads

...100 tasks required when performing the installation of Oracle primary and standby database servers. This graphical application...Windows, Linux and Mac OS X -- Improved Security Implementation -- Implement Oracle Best Practices -- 15...are Supported -- Post-Install Tasks are Supported -- Oracle 9i UNDO Tablespace Supported -- Create Standby Database...
 
oraclestandbyomsoemsilent installprimaryrmanrecovery
PHPRunner

Shareware by XLineSoft
12 x 3200Kb downloads

...for any MySQL, MS Access, SQL Server and Oracle databases. Your web site visitors will be able...delete and export data in your database. Advanced security options allow to build password-protected members only Web...
 
updatedatabasedeleteservermysqlphpaddgeneratoronlinecode
...SQLaps SQL Assistant for Oracle: 1) Supports the Oracle Server version - 8i/9i and 10g support HAS...of the Schemas,Functions,Procedures,Packages,simple and partitioned Tables,Indexes,Constraints,Views, Triggers. 5) Security management (Creating and management roles and profiles, grant...8) Improved, useful and fast interface for the Oracle Logminer (view/run stored statements for the executed transactions...
 
softwarelogmineroracleutilityassistanttoollow costsqlmanagementdevelopmentdatabase
TheDatabaser

Shareware by The Databaser, Inc.
9 x 100335Kb downloads

...TDB represents a paradigm shift in the way database applications are developed. Now we have a database...organizations of any size to develop and maintain database management systems that fit their specific needs economically....that allows TDB to interact with most other database platforms. MS Access, Excel, DB2, Oracle, and the...others. In response to the new government HIPAA security requirement ENCRYPTION/DECRYPTION routines have been added.
 
chartmanagementimportreporteasylabelsqlcreateexportdatabasetouchscreentool
...EMS SQL Manager for Oracle Freeware is a high performance database tool for...Oracle database development and administration. SQL Manager for Oracle works with any Oracle versions from 8.1.7 to...the newest one and supports the latest Oracle Database features and data types including compressed, OLAP, read-only...clause and others. It offers plenty of powerful Oracle tools for effective Oracle security management...
 
oracle schemaoracle managementoracle create databaseoracle script databaseoracle database toolsoracle toolsoracle administrationoracle queryoracle database schemaoracle developeroracle database design
...to design some additional reports. You know the database structure pretty well and created some mapping tables...print and export the data. You may use Oracle SQL plus or MS SQL Server Management studio...the end users. You can edit user menus, security settings and data entry forms. All this complexity...
 
table editordata entry forms
Oraspeed SQL Editor

Shareware by Oraspeed
16 x 11407Kb downloads

...Using this Oracle IDE you can write and test Queries. Create,...your PL/SQL Programs. Execute Anonymous PL/SQL Blocks. Create/Edit Database object using advanced wizards. TKProf, PL/SQL Profiler, Parent...Tables Data Explorer,Built-in reports, BLOB Editor, Session Manager,Oraspeed Security Module, Multithreading, File AutoRecover and much more. This...Profiler, PLSQL Debugger, TKProf will save your time. Oracle debugger is so easy to use. SQLNet.ora Editor...
 
oraspeedplsqltkprofschema browserwizardoracle idecreateprofilerautotracedebuggereditorobject
dbQwikSite PE Plus

Commercial by TheDevShop Ltd.
9 x 12595Kb downloads

...-Context sensitive click on HTML -Generates complete interactive database web sites with no coding -Generates both ASP...either Unix or Windows -Works with most popular databases such as: MS SQL, MS Access, Oracle, DB2...Authorize.net and WorldPay -Integrated web publishing support -Integrated database management tools -Database "Up Sizing" and "Down Sizing"...and conversion support -Integrated Security -Complete PC Test Environment -Localization...
 
mysqlweb designcreate web pageweb databaseweb site softwareasponline databasephphtmluser securityweb developmentfree
Oracle Maestro

Shareware by SQL Maestro Group
6 x 17245Kb downloads

...Oracle Maestro is a powerful solution for the Oracle server administration and development. Key features include: -...support for all Oracle versions on the market; - easy database object...management; - database designer; - PL/SQL debugger; - data management: viewing,...
 
functionsfronttabmyadminadministrationtypesadministratorinterfaceguioraclesecuritymanagementpackageseasy-to-usestoredbuilderviewsserverclientdatabaseproceduresdevelopmentscripteditorsynonymssequencestriggerstool
...EMS SQL Manager for Oracle is a high performance database tool for Oracle...database development and administration. SQL Manager for Oracle works with any Oracle versions from 8.1.7 to...the newest one and supports the latest Oracle Database features and data types including compressed, OLAP, read-only...clause and others. It offers plenty of powerful Oracle tools such as PL/SQL Code Debugger, Backup/Restore Database...
 
oracle create databaseoracle queryoracle importoracle toolsoracle managementoracle schemaoracle database schemaoracle script databaseoracle administrationoracle exportoracle database designoracle database toolsoracle developer