1 2 3 4 5 6 7 8 9 10 11 12

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a rich browser-based interface. Access...over SSL (LDAPS). Support for standard public key encryption and signing of e-mail encapsulated in S/MIME is...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
71 x 674Kb downloads

Free Vista Files award
...controls, charting and graphing components, email components, data encryption components, user interface suites and many more! Dev...best tools for the job, every time. Its online directory enables software developers to quickly and accurately...
 
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
FREE CompuSec

Freeware by CE-Infosys Pte Ltd
171 x 20800Kb downloads

Free Vista Files award
...provides other software components such as Identity Management, Encryption of Server Files & Subdirectories – SafeLan, Encryption...of individual Files - DataCrypt, Encryption of diskettes, CD/DVD and removable media - CDCrypt,...Encryption of Voice Communication – [ClosedTalk] and Container Encryption - [DriveCrypt] using strong AES algorithm 256 bit...the need to encrypt entire hard disk.
 
secure internet callsencryptscddvd encryptionfree callsdata encryptionauthenticationaccess controlfree computer callstabletprotectionsecure communicationvoipsecurity
smc WebStore Free

Freeware by smc technologies, Inc
94 x 4146Kb downloads

...Create an online catalog and sell your products online with a FREE ecommerce solution. Designed to be...products from your website. Integrate a fully browseable online catalog with secure shopping for your visitors. Friendly...and easy to use online tutorials to get your store up and running...script installation or programming experience necessary! Supports SSL Encryption in checkout area and administration screens for our...
 
e-commerceecommercestorefrontshopping cartsshopping cart programsebusiness softwareshopping cart softwareeasy shopping carte-business softwareshopping cart systems
Free Vista Files award
...Using powerful 256-bit AES encryption technology, the iOpus Private Internet Gateway (iPIG) creates...data from even the most sophisticated methods of online spying and snooping like the "Evil twin attacks"....client or chat software and switch the iPig encryption on: iPig grabs all Internet traffic before it...
 
public hotspotopensslwpaproxyaeswlannetworkssh80211 abgwepsecuritywifivpnwirelesswi-fiencryption
...minute. Free client software. Using powerful 256-bit AES encryption technology, the iOpus Private Internet Gateway (iPIG) creates...data from even the most sophisticated methods of online spying and snooping like the "Evil twin attacks"....client or chat software and switch the iPig encryption on: iPig grabs all Internet traffic before it...
 
secure accessserverwpapublic hotspotaesproxysshnetworkwi-fiwlan80211 abgencryptionsslwepsecurityopenwifivpnwireless

Freeware by MySoCo.com
44 x 887Kb downloads

...FileBarricader™ 2007 is primarily a file encryption utility. In this day and age the protection...Computers are used for just about everything today: online shopping, running businesses, surfing the net, communicating with...is almost immeasurable! And this is where file encryption finds its place in modern day computing. File...fast file encryption; - Includes only the best encryption algorithm: Rijndael (AES); - Includes only the best...
 
rc2file protectionfilebarricadercryptographysecurityencryptiontripledesrijndael

Freeware by IRCXpro
53 x 6662Kb downloads

...add your buddy’s and see when they are online / offline and Channel Operators can take advantage...full Windows Domain integration using NTLM and SSL Encryption support (for both Client to Server and User...
 
chattalkircdconferenceircxmirc
Autoformfiller Free

Freeware by Auto Form Filler
38 x 2832Kb downloads

...and fill any complex web form. - Save online ID and Password - Fill online ID and...Password - Save Form - Fill online Form - Strong encryption features - Includes basic...
 
form filling softwareautoformform filleraccount logon loginmemorize passwordssave online formfill web formsquick launch sitesfill forms automaticallysave passwords
...security is provided in two different modes: symmetric encryption with shared secret key and asymmetric encryption with...responsible for keeping information on and authentication of online peers. All peers connected to a particular hub...
 
securepeer-to-peerprivate
KeePass Password Safe

Freeware by Dominik Reichl
34 x 1300Kb downloads

...logon, your e-mail account, your homepage`s FTP password, online passwords (like website member account), etc. etc. etc....are encrypted using the best and most secure encryption algorithms currently known (AES and Twofish). For more...at its full source and check whether the encryption algorithms are implemented correctly....
 
openmanagersafesecurekeepasspasswordcodedatabasesecurityencryptionkeyfreemasterdisksource
iGo Incognito

Freeware by Incognito Systems
71 x 1541Kb downloads

Free Vista Files award
...is built on a combination of public key encryption and the US Advanced Encryption Standard (AES). If...can see in real time whether friends are online or not, you can send messages and files,...can. And your friend doesn`t need to be online to receive the message - iGo Incognito supports...completely optional. Registration gives you access to huge encryption keys, ability to organise enormous chats/forums, a much...
 
folderdiscussionfileencryptionprivacychataesvoice messageinstantsecuritypublic keyforum
Bingo Fantasy

Freeware by Bingo Fantasy
37 x 184Kb downloads

...At Bingo Fantasy you can enjoy online bingo at its very best. Our game uses...available at no other bingo in the world! Online or land-based! Our loyalty scheme pays instant Bonus...lost when a connection is dropped. Our advanced encryption systems ensure total security of all personal information....
 
slot machineonline bingofree bingolottokenoonline slotsbingo softwareplay bingobingo onlinebingo game
Bingo 777

Freeware by Bingo 777
23 x 177Kb downloads

...Founded in 2003, Bingo777.com is online bingo at its best. The site has four...us as they are to you. Our advanced encryption systems keep personal information secure, and we use...lost when a connection is dropped. Our advanced encryption systems ensure total security of all personal information....
 
slot machineonline slotsbingo onlinefree bingobingo777bingo softwareplay bingolottokenobingo gameonline bingo
MyDiskServer

Freeware by Michael Gardiner
155 x 250Kb downloads

Free Vista Files award
...mobile phones. Supports multiple user accounts and SSL encryption for secure data transfers. Can automatically generate zip...MyDiskServer helps configure your computer for sharing files online and manages all network traffic between users and...the host yourself network. After registering an online identity and choosing files to share, the files...
 
streamsimplejavautilityhost yourselfhostingmydiskserverwebservershareapplicationsharingzipphotosfilessoftwaremusicgallery
ViPNet OFFICE

Shareware by INFOTECS GmbH
31 x 63335Kb downloads

Free Vista Files award
...an IP VPN and it provides secure client-to-client encryption so that mobile workers, home workers, and remote...IDS, tunnel securing Internet traffic between your offices, online visibility of vpn users and other features. ViPNet...instant messaging (IM), encrypted business mail, file exchange, online visibility of vpn users and other features. ViPNet...
 
firewallencryptionvpnvpn softwareinternet securityvpn clientpersonal firewallvpn servervpn gateway
Secrets Protector Pro

Shareware by E-CRONIS Software
37 x 1232Kb downloads

...help you to protect your secret data and online privacy better than ever. All confidential data will...be DELETED. Your personal classified data and your online and offline activity traces will be wiped for...Mode nor in other operating systems. The strong encryption used in Secrets Protector Pro assures an extra...
 
evidencesafewipeunhidelock folderprivate filesecuresecurityguarddiskprotectsensitivelock fileseraserdeletesecrethide foldersprivacyinvisible
Internet Neighborhood Pro

Shareware by KnoWare, Inc.
19 x 4882Kb downloads

...files and directories. SSL, SSH and S/Key password encryption support provide security. A file transfer manager enables...
 
namespaceftp clientknowareftp utilityfile transferinternet neighborhood
Folder Lock

Shareware by New Softwares.net
338 x 9084Kb downloads

Free Vista Files award
...and real-time backup of encrypted files to an online storage. It also offers portable security for USB...the only product that offers 256-bit AES on-the-fly encryption as well as syncing of encrypted files to...an online storage. No need to decrypt or manually backup...
 
protect folderspermanently deletepassword protect foldersfile lockingbackup onlinefile encryptionpassword protect usb drivefolder lockdata securityonline backupdata protectionsecurity suite
Max PC Secure

Shareware by Max Secure Software
35 x 22363Kb downloads

...etc - Max Anony Surf : Keeps your online activites private without being traced. - Max PC...
 
securityprotect privacyspyware detectorboosterdata encryption and safetypopup killer