1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...can be created and downloaded from the Universal dictionary system at: http://www.dicts.info/uddl.php . Universal dictionary currently interconnects...Portuguese, Russian, Slovak, Slovenian, Spanish, Swedish and Turkish. Online dictionaries are at: http://www.dicts.info...
 
freewareeducationdownloadableapplicationtranslationbilinguallanguagedictionaryoffline
Free Bible Study - Add Any Texts

Freeware by BibleOcean.com
90 x 5859Kb downloads

...a topic you are studying. Import sermons, talks, online research, essays etc. 1 click search. Features include:...
 
greekjesuschristianconcordancelexiconnivwordwindowschurchhebrewmarkbiblematthewlukedictionarygodjohn
TheSage English Dictionary and Thesaurus

Freeware by Sequence Publishing
114 x 29442Kb downloads

...TheSage`s English Dictionary and Thesaurus is a one-click complete dictionary and...and does not use your Internet connection. The Dictionary comprises: +210,000 multiple detailed definitions, +50,000 examples of...standard and advanced wildcard search functionality, anagram search, online search, definition and example concordancer (so-called reverse search),...
 
speechword listspronunciationdictionarylookupthesageone-clickthesauruswildcard searchconcordancerenglishanagram
Screen Master

Freeware by Zhenxiao
70 x 383Kb downloads

...simplify and speed up screen capture. Also available online dictionary wiki note system:...
 
video capturesnapshotscreen capturerecord screen
ABC Scrabble

Freeware by 2M Games
111 x 996Kb downloads

...and Letters fans. It relies on the ENABLE dictionary (including 154,000 words from 2 to 9 letters)....
 
scrabblestoolonlinefreeplaylettersgamescrosswords
Hunter Dictionary II

Freeware by www.graphichunter.com
43 x 2635Kb downloads

...Hunter Dictionary II is a free multifunction online dictionary for translating English word to Chinese, English or...Japanese. It is also an specialized dictionary for thesaurus and computing terms. Hunter Dictionary II...contains no dictionary database itself. Instead, it is a specialized Internet...Browser, user can use it to browse the online Dictionary Service (e.g. Yahoo Chinese Dictionary, MSN Encarta, Thesarus.com...etc).
 
free online dictionaryenglish-to-chinesethesaurusenglish-to-englishmultifunctionthesaurus dictionarydictionary computingenglish-to-japanesefree dictionary
Hunter Dictionary

Freeware by www.graphichunter.com
35 x 2630Kb downloads

...Hunter Chinese Dictionary functions as an English-to-Chinese online dictionary. However Hunter Chinese Dictionary contains no dictionary...Browser, user can use it to browse the online Internet Dictionary Service (e.g. Yahoo Chinese Dictionary) to...achieve the Chinese Dictionary function. It greatly improve the time used to...
 
chinese dictionaryenglish wordenglish-to-chinesefree dictionarytranslatefree online dictionarychinese meaning
WordWeb

Freeware by WordWeb Software
67 x 21433Kb downloads

Free Vista Files award
...over 150 000 root words. If you are online you can also easily check web references such...
 
thesaurusdictionaryenglishoxfordwordsynonymlexiconwebster
Bible Seeker

Freeware by Ragan Lockette
43 x 8145Kb downloads

...the Whole Bible. FEATURES: - Lookup words in dictionary by highlighting and right-clicking. - Lookup commentary entries...
 
studykjvresearchdictionarybiblecommentary
...and vocabulary activities. Features include 9,000 Word English Dictionary word-database and State of the Art Graphics. The...
 
finderchildrensspellingkidsgameswordsenglishfreeonlinevocabulary
KanjiBrowze

Freeware by MindDate Software
28 x 1493Kb downloads

...or as flashcards. Version 2.1 now supports Chinese dictionary files, the Microsoft IME for entering Japanese or...Chinese characters, and has many other small improvements. Dictionary files in the EDCIT format are available online...for Japanese, Simplified Chinese and Traditional Chinese. No dictionary file is part of this distribution, but the...
 
kanjijapanesedictionarychinesehanzimandarinedict
Desktop Assistant

Freeware by Sphinx Software
28 x 558Kb downloads

Free Vista Files award
...access from almost any application to the free online reference resource with English, Medical, Legal, Financial, and...
 
locatelibrarythesaurusreferenceassistantfinddictionaryidiomssearchencyclopediafreeacronyms
EZDictionary 1.1

Freeware by EZDictionary.com
17 x 144Kb downloads

...EZDictionary is a dictionary helper designed to help users to quickly look...
 
freeware
KeyText

Shareware by MJMSoft Design Ltd.
79 x 2739Kb downloads

Free Vista Files award
...if it`s a zip code, goes to an online map; if it`s a URL, goes to the...site; if it`s one word, does a dictionary lookup. Now includes advanced features such as regular...
 
automationalarmpasswordmacroclipboardkeyboardautomatescheduler
IE Translator

Shareware by Sarm Software
22 x 698Kb downloads

Free Vista Files award
...sites in your native language! Unlike the free online translators, Sarmsoft IE Translator never puts any advertisements...better translation quality? Sarmsoft IE Translator supports automatic dictionary updates over the Internet, making the translation better...
 
web pagestranslationonlinetranslatewebsitesinternet explorerservicedictionarytoolbartranslator
Foxy

Shareware by 2 power n
22 x 1000Kb downloads

...yet unknown sources are blocked. * Tracks users` online activity and generates traffic reports. And much, much...
 
content filtering proxyscriptbannerstraffic reportsblocks popupscookiesdictionaryparental control
OneNote Password Recovery Key

Shareware by Passware
26 x 821Kb downloads

...recovered using a combination of Brute-Force, Xieve(tm) and Dictionary attacks. OneNote Password Recovery Key includes support for...reports are just a few new features. Includes online help and full install/uninstall support....
 
lost passwordfreeonenote password crackeronenote password recovery key
Powerpoint Password Recovery Key

Shareware by Passware
34 x 861Kb downloads

Free Vista Files award
...recovered using a combination of Brute-Force, Xieve(tm) and Dictionary attacks. Powerpoint Password Recovery Key has support for...reports are just a few new features. Has online help and full install/uninstall support....
 
pptfreepowerpoint password crackerppspassword recoverylost passwordpresentation
TranslationExpress

Demo by Javvin Company
26 x 250000Kb downloads

...designed for people who need to do instant online translations. It includes 6 translation engines to perform...technologies employed for high quality translation results. Comprehensive dictionary database including 6 general and 49 specialty dictionaries...
 
dictionaryenglish chinesechinalanguage programtranslationforeign language
Aqua Deskperience

Shareware by Deskperience
19 x 2270Kb downloads

...by email or search it in hundreds of online resources.You can also take notes from screen or...
 
desktop searchpassword recoverycapture textshow passwordtranslatetext grabberdictionaryextract textsearch aggregationgrab textnotesspell checkscreen capture