1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Multiple Interface Watcher

Shareware by Carsten Schmidt
15 x 983Kb downloads

...Multiple Interface Watcher, MIW.exe Version 1.1.0; April2005 Shareware by Carsten Schmidt If you like this software and continue using it, please buy it. The price is only...
 
multiple interface watchergraph utilitynetwork utilisationsnmpmonitoringmiwexe
File Backup Watcher Professional

Shareware by Desktop Software
20 x 13158Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...data can be backed up to local or network drives, floppies, ZIP drives, CDs and DVDs. Besides...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
backupmulti-threadedwindows2000auto-dialrestorewindows98compresscopypkzipmulti-usermirroringwin32automaticbackupsafekeepauto-loginsynchronizepasswordprotectionwindowsntcompression
Free Vista Files award
...Capturix NETWorks is a network utility software that ables you to test and...can show all information related with a specific network card or connection, Speed Meter, Route Information, IP...and Bandwidth Log. Now It brings the Connection Watcher software. PingCheck lets you ping a list of...
 
scannertraceterminaltcpipnetworkhttpnetworkingwinsspeedserverbandwidthinternetsmtprouteconfigdhcprouterlookuppingmeterwhoismaildnsport
Clipboard Genie

Shareware by Vsisoftware.com
23 x 1732Kb downloads

...your Clipboard can also be sent over the network to another PC running Clipboard Genie 4.1 Windows...
 
sendkeyssoftwarestringinternetpasteszamodygenieutilitykeystrokescutvsisystemsclipboardrunwatcherclipbaordhotkeysnetworkcopyapplicationgraphics
...have been viewed on your computer. Web Surfer Watcher operates hidden in the background, recording Web site...Opera, or Mozilla. You can configure Web Surfer Watcher to either record this limited information form these...
 
monitor web usemonitor internetweb securitymonitor web accessmonitor internet usemonitor web usageinternet security
DHCP Watcher

Shareware by ALSEDI
29 x 453Kb downloads

...DHCP Watcher is a protection and analizing tool for users...of corporate and home networks where DHCP server is used to provides network...configuration parameters. Most networks are used a DHCP. DHCP Watcher is unique...tool for controlling a network properties created for users (system administrators can use...have been used only in ALSEDI Group. DHCP Watcher 5 is developed for usage outside a ALSEDI...Group.
 
detectionevidencepropertiesnetworkdocumentintrusiondhcpbusinesssecurity
File Backup Watcher Lite Edition

Shareware by Desktop Software
24 x 15335Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...data can be backed up to local or network drives, floppies, ZIP drives, CDs and DVDs. The...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
win32backupmirroringcopymulti-threadedsafekeepautomaticbackupwindows2000restoreauto-dialsynchronizewindowsntpasswordprotectionauto-loginmulti-usercompressionpkzipwindows98
PingIT

Shareware by Desktop Software
20 x 198Kb downloads

...who want to know all the time about network loading, who wants to understand who is guilty...want to watch loading of remote servers and network services and their availability (if they work or...
 
portmonitorutilitiestrayserverstatussocketnetworksystemwebcheckwatcherpingitserviceicmploadingadresspinger
Internet Watcher 2000

Shareware by Bernard D&G
19 x 1347Kb downloads

...Internet Watcher makes surfing faster by removing banner advertisements, Pop-Up...frame of animated images. In addition to saving network resources, Internet Watcher makes pages easier to read...those cookies that are violating your privacy. Internet Watcher makes it easy to accept cookies normally, block...the existing cookies on your computer. Because Internet Watcher 2000 is a true proxy server, it can...share a single Internet connection.
 
httplanguagead-filterserverpop-upprotectioncookieproxychildrenparentalblockerwebscriptjavabannerkiller

Freeware by vdocapture.com
40 x 4854Kb downloads

...Netcam Watcher Professional is a Digital Video Recorder for Network...or people walking past the window. Use Netcam Watcher Remote Control to view your cameras and recordings...
 
cameranetwork
...Easy File and Folder Watcher lets you watch monitors activity in folders on...
 
watchingfilesmonitor activitymonitor foldertoolscontentutilitiesspyprotectmanagesecuritymonitor file
IP-Tools

Shareware by KS-Soft
36 x 1587Kb downloads

...This award-winning tool consists of 19 network utilities that offer a large viriety of network...
 
lookuphostmonitorfingertelnettracescannerwhoisping
OstroSoft Internet Tools

Shareware by OstroSoft
27 x 4873Kb downloads

...Award-winning integrated set of network (Internet) utilities. Contains scan wizard, port and domain...
 
watcherdomainconnectionnetstatinternetostrosoftportfingerscannertoolspingftputility
...Watch up to 24 webcams simultaneously! Save any frame as a picture, or use any webcam as your screensaver. You can zoom in and zoom out of any webcam. You...
 
security camera softwarehome security camera setupscamera surveillance softwarelive web camswebcam softwarenetcam softwarewireless security camerascamera network softwaredigital video recorder
File Backup Watcher 3 Professional

Shareware by Desktop Software
13 x 8044Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...data can be backed up to local or network drives, floppies, ZIP drives, CDs and DVDs. Besides...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
pkzipwindowsntcompressionautomaticbackupmirroringmulti-userauto-dialsafekeepmulti-threadedwindows2000passwordprotectionauto-logincopysynchronizerestorewin32windows98
File Backup Watcher 3 Lite Edition

Shareware by Desktop Software
12 x 2534Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...data can be backed up to local or network drives, floppies, ZIP drives, CDs and DVDs. The...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
synchronizewindows2000win32compressionpkzipauto-dialauto-loginautomaticbackupwindows98multi-usercopyrestoremirroringpasswordprotectionmulti-threadedsafekeepwindowsnt
Syslog Watcher Pro Edition

Shareware by SnmpSoft Company
63 x 3874Kb downloads

...Gather syslog data from network appliances and workstations. Syslog Watcher Pro Edition collects...syslog information from network devices via UDP and TCP protocols, and works...in IPv4 and IPv6 networks. Syslog Watcher Pro records, stores, organizes and displays system logs,...reports. Syslog is a modern standard for logging network appliances and workstations. Syslog Watcher Pro Edition empowers...
 
windows syslog servercisco syslogwindows 2008 syslogsyslog viewersyslog servicesyslog watchersyslog parsersyslog reportsyslog messagenetwork monitoringwindows 2003 syslogsyslog collector
Free Vista Files award
...host not found, low bandwidth or any other network error. Utility alerts you via notifying with email...alerts with a beep sound. * Multithreaded site watcher software provides easy to use interactive graphical user...
 
serversupportsysteminternetdowntimeonlinealertservicetrafficreal timeutilitycheckeravailabilityremotewebsitenetworktoolofflineenhancesoftwarestatusmonitoringperformancetrackeruptime
Website Performance Analyzer Tool

Shareware by Data Recovery Tools
14 x 1280Kb downloads

Free Vista Files award
...affected by a poor internet connection. Website availability watcher tool monitor performance of your web pages, IP...
 
servicessoftwareabsentwatcheralertnetworkcheckshttpspop3utilityemaildowntimesmtpftpperformanceanalyzeapplicationwebsitestatuspingprotocolservermonitoringuptimehostingavailability
...Remote Network Watcher is a new sophisticated software designed by Softinventive...performance to his network. Should any of the network computers, servers or system utilities fail to perform,...Remote Network Watcher will immediately alert you about such failures and...improve the irregularity or error to restore perfect network performance. Don`t worry about troubles with computer or...provide continuous lawless performance of your network.
 
remote softwareasset monitoringserver monitoringnetwork trackingnetwork management softwarenetwork checksnetwork watchernetwork mapnetwork control