1 2 3 4 5 6 7 8 9 ... 24 25 26 27 28 29 30 31 32 33 34 35

Sort by : ReleasedNameDownloadsAddedRatingRelevance
CodySafe CommPack

Freeware by Codyssey.com
6 x 11249Kb downloads

...portable applications, compiled to serve the needs of network administrators, computer maintainers and IT specialists. The suite...are combined to the following categories: - System tools - Network Tools - Utilities - Files and...FTP Management tools - Editors - System information tools - Password recovery tools - Data recovery tools...- Privacy and Security tools - Disk tools Please keep in mind that the Admin Pack...
 
voipinstant messengerremovable diskcodysseyskype portablecodysafeusb flash driveportableappsportable applicationslaunchermenu
progeBILLD HVAC Piping for progeCAD

Shareware by progeCAD USA
7 x 344498Kb downloads

...and Find and Replace text and attribute search, Network NLM, USB mobile, and corporate licensing options, over...
 
turbocadsolid modeldraftingautolispprogecadstructuralcivil surveyengineerautocadprogesoftelectricalarchicadintellicadmechanicalarchitectmepaecdwgvectorworksrenderautocad litebuilding
Master Commander

Freeware by Andrzej Stefanczyk
7 x 4587Kb downloads

...specified group of folders and files * a tools for share files and folders on the local...
 
file managercommander
...At times working with Microsoft Active Directory can be complicated. Using active directory tool - Lepide Active Directory Manager, active directory can be managed easily and effectively. It is one such...
 
reportsactive directory reportsmanagementactive directory toolsactive directory managementmanage active directory
NetWrix All-in-One Suite

Shareware by NetWrix Corporation
3 x 106400Kb downloads

...is the most complete set of systems management tools for IT professionals. The Suite includes products for...are supported: Active Directory, Exchange, VMware, file servers, network devices, SQL Server, SharePoint, NetApp, EMC, and others....
 
complianceidentity managementchange auditinge-discoveryvirtualizationendpoint security
progeBILLD Mechanics/Structural

Shareware by progeCAD USA
3 x 344498Kb downloads

...and Find and Replace text and attribute search, Network NLM, USB mobile, and corporate licensing options, over...
 
engineerrendercivil surveydwgarchicadautocadelectricalmechanicalbuildingintellicadstructuralprogesoftsolid modelvectorworksautocad litearchitectmepturbocaddraftingprogecadaecautolisp
CodySafe Admin Pack

Freeware by Codyssey.com
8 x 41149Kb downloads

...portable applications, compiled to serve the needs of network administrators, computer maintainers and IT specialists. The suite...are combined to the following categories: - System tools - Network Tools - Utilities - Files and...FTP Management tools - Editors - System information tools - Password recovery tools - Data recovery tools...- Privacy and Security tools - Disk tools Please keep in mind that the Admin Pack...
 
portable applications portableapps launcher menu USB flash drive removable disk CodySafe Codyssey
NBGet Internet Download

Shareware by NBGet inc.
6 x 6372Kb downloads

...1. Internet Download is the best internet download tools to realize 500% faster download any files from...Internet. 2. Don`t worry about unreliable, slow connections, network hang, or interrupted download. If an download interrupts...
 
progeEARTH Land Development Suite

Shareware by progeCAD USA
5 x 1820Kb downloads

...and Find and Replace text and attribute search, Network NLM, USB mobile, and corporate licensing options, over...
 
land developmentautocad literenderarchicadautolispcivilintellicadbuildingarchitectcivil surveydraftingsolid modelland desktopvectorworksdwgturbocadprogecadsurveyingmechanicalprogesoft
YouTube Downloader

Shareware by uTube Soft inc.
30 x 6372Kb downloads

...download, Don`t worry about unreliable, slow connections or network hang. If an download fails before completion, it...
 
download youtube videoyoutube downloader
Recover Keys

Shareware by Recover Keys
3 x 4501Kb downloads

...to find all the software keys among all network computers. This may save you a lot of...
 
administrativeofficeproduct keyserialsoftwarelostreinstallrecoverfinderactivation keybackupwindowsadmin toolscd-keyrecover lost adobe keysustemretrieve
progeCAD Professional AutoCAD Clone

Shareware by progeCAD USA
6 x 258667Kb downloads

...and Find and Replace text and attribute search, Network NLM, USB mobile, and corporate licensing options, over...
 
turbocadsolid modelprogesoftarchitectdwgautocadmechanicaldraftingvectorworkselectricalcivilautocad litebuildingaecprogecadcivil surveyarchicadmepautolisprenderengineerstructuralintellicad
Secure Cisco Auditor

Demo by Secure Bytes
2 x 318968Kb downloads

...is a state of the art Next Generation network security auditing software for Cisco firewalls, routers and...switches along with different Router audit tools and Network security Software. Secure Cisco Auditorâ„¢ (SCA) is the...most advanced user friendly network security auditing software in its domain. Cisco security...audit tools are specially designed for network devices such as the Cisco ASA firewall, PIX...
 
security auditcisco securityaudit ciscocisco routercisco security auditcisco toolsrouter audit toolrouters switchesauditing softwarefirewall auditnetwork securitycisco auditsecurity auditing softsecurity software
...Plax Network Suite is an easy to use collection of...network tools which give you full control over the internet...case you need and instant internet lockdown, Plax Network Suite offers the possibility to block all internet...want to cloak your computer IP address, Plax Network Suite can instantly block all inbound ping connections....one of the most popular features of Plax Network Suite is the visual report of all open...applications.
 
plax network suite securityvulnerabilitynewstipshackercomputer security newshackingspywareadwareadvisories
VisioForge Video Capture SDK .Net

Shareware by VisioForge
3 x 30358Kb downloads

...input, video format, and frame rate. The processing tools allow creating movie previews, overlaying the picture with...multiple screens, WinForms and WPF applications. The audio tools include a volume booster, equalizer, and a 3D-bass...
 
webcammpegvideocameracapturetunercamcorderwmvflash
Spiceworks Free IT Management Software

Freeware by Spiceworks Inc.
5 x 45844Kb downloads

...Spiceworks is free network management software and help desk software designed for...quote), help desk software, an IT knowledge base, network inventory, network monitoring, IT reporting, network configuration management,...your network; use built-in TFTP server tool for network configuration management; manage employee profiles in Active Directory...using People View; monitor your network for new software, license compliance violations, low...
 
network monitoringnetwork managementnetwork troubleshootingsql server monitoringhelp desk softwarerfq request for quoteups power managementknowledge baseactive directory managementtftp serversnmp toolsnetwork inventory
System Nucleus Portable (x64)

Freeware by Spencerberus.com
5 x 3187Kb downloads

...& settings, consolidating functionality that normally requires numerous tools into a single interface designed to make these...of a machine`s hardware, software & settings, optimize network performance, and disable those annoying programs that start...
 
maintenanceaudituninstalleradministrationconfigurationtweak
System Nucleus Portable (x32)

Freeware by Spencerberus.com
3 x 3124Kb downloads

...& settings, consolidating functionality that normally requires numerous tools into a single interface designed to make these...of a machine`s hardware, software & settings, optimize network performance, and disable those annoying programs that start...
 
configurationtweakaudituninstalleradministrationmaintenance
System Nucleus

Freeware by Spencerberus.com
5 x 3429Kb downloads

...& settings, consolidating functionality that normally requires numerous tools into a single interface designed to make these...of a machine`s hardware, software & settings, optimize network performance, and disable those annoying programs that start...
 
configurationuninstallermaintenanceauditadministrationtweak
FrostWire Ultra Accelerator

Freeware by Traffic Speeders
4 x 4920Kb downloads

...FrostWire Ultra Accelerator is an enforcing add-on module for the fresh but already popular Frostwire client of the famous LimeWire file sharing network. This plugin will be perfectly implemented...
 
p2p pluginsfrostwire boosterfrostwire acceleratorfrostwire speederp2p acceleratorsaccelerate downloadsp2p toolsaccelerate p2paccelerate file sharingp2p utilities