1 2 3 4 5 6 7

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...Applications Manager offers a single integrated monitoring tool suitable for application monitoring, database monitoring, system...monitoring, website monitoring, services monitoring, and custom application monitoring. Applications Manager proactively...monitors applications and servers and notifies problems in network through e-mail/SMS. It provides graphs and reports that...performance and availability data of the monitors.
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
ManageEngine OpManager

Freeeware by AdventNet Inc
131 x 39569Kb downloads

...Are you using multiple tools for your network management needs? Put a stop to the daily...along with disparate management tools! OpManager is a network and IT infrastructure monitoring solution that offers advanced...and performance management functionalities across WAN, VoIP services, network devices, servers, services, applications, databases and much more....
 
network monitoring toolnetwork management softwareserver management software
...TrafficStatistic makes it possible to view statistics on network usage and has it`s focus on payment relevent...The user is able to see which hosts, services or ports were the top traffic consumers. MZL...- internet users are able to see, which services cause the most traffic - internet users are...bandwidth metered charge plan get up-to-date statistics - network operators can see bandwidth consumption cut by host...
 
ethernetgatewaystatisticsinternetnetworktraffic analysisdslconnectionbandwidth usage statisticspacketscablebandwidth monitoringipdrvolumedata collectorreportonlinebroadbandtariff
...files and folders on computer hard drives, laptops, network servers, emails, USB sticks and drives, CD-ROMs and...works with limited privileges. It encrypts/decrypts outside the network without restriction. DeltaCrypt USB is a hardware independent...backup copy functions are available. Complete audit and monitoring with log recording increases environmental awareness. Data leakage...
 
computer software applicationdecryptionfips 140-2user accountprivacybluetoothsecuritydigital signatureadmin rightsmobile devicesmass storage devicesrinjdaelfips 140-2 certificationprotectionfloppy discrecuperation keyhashingusb keyemail
TCP Spy .NET Standard Edition

Freeware by Devolutions inc.
18 x 576Kb downloads

Free Vista Files award
...client and a server. Optimized for .NET Web Services or Web Site TCP Spy .NET will help...host. It`s a 4 in 1 tool: - monitoring tool - web service / web site profiling...tool - redirection server - Network / Web Site / Web Services spy Features:...user interface - Auto update - Free 2. Monitoring - Monitor connection IP address - Monitor connection...
 
httptcpsmart clientprofiler
EF System Monitor

Shareware by EFSoftware
24 x 838Kb downloads

Free Vista Files award
...the Windows 9x you can use the advanced services provided by these Windows platforms, like process and...
 
cpusystem monitormemoryefsoftwareefsysmon
LinkAlertPC

Shareware by InBloom Products
13 x 4470Kb downloads

...Extensive event control includes Start, Stop and Resume monitoring of one or all links. A Test facility...
 
networkhttpsserviceftpfileemailmonitorlanibpfolderdiskinbloomtcplinkalertpcnotificationprinter
NetWatcher

Shareware by Toleron Software
27 x 802Kb downloads

...Toleron Netwatcher is aimed for: *controlling the network integrity - both logical and physical; *monitoring the...carrying capacity of different network parts; *tracking status and response time of the...widely distributed network services (HTTP, SMTP, POP3, FTP etc.). Netwatcher was initially...usage of dynamically loaded modules (plug-ins), which gather network status information, process and display statistics as well...
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping
Network Eagle Monitor

Shareware by Extromatica
18 x 4366Kb downloads

Free Vista Files award
...Network Eagle Monitor is a network monitor designed to inform you of network problems...managers do. You can monitor the network, servers, network services, hosts, devices, applications and databases. By running...recorded to a log file for future reference. Network Eagle Monitor lets you get started right out...SQL server via native interface, monitor local and network printers, and that`s just the beginning! You can...
 
server monitordiagnostic softwarenetwork management softwaretcpip softwarenetwork server softwarenetwork monitor softwareport monitoring software
Advanced Administrative Tools

Shareware by G-Lock Software
25 x 3087Kb downloads

Free Vista Files award
...Have you been port scanned lately? Completely ignoring network security is not smart and ignorance isn`t exactly...AATools investigates and gathers information about your computer, network status, and service availability. That is a layman`s...it performs an inspection on everything vital to network security as it pertains to the protection of...available and what application is utilizing them.
 
verifierscanneraatoolsemailregistrynetworkproxyanalyzermonitorportcleaner
NetCrunch

Demo by AdRem Software, Inc.
20 x 258766Kb downloads

...NetCrunch 8 is an all-in-one and agentless network monitoring and management system, capable of monitoring every device...8 monitors the performance and availability of 65 network services, including Ping, HTTP/HTTPS, SSH, FTP, DNS, SMTP,...A Netflow traffic server is included, that integrates network traffic flow data from a range of devices...monitor routers, switches, printers, firewalls, sensors, and other network devices.
 
network mappingmonitoringperformance monitoringsnmpv3netflowbandwidth monitoringnetwork managementnetwork monitoringtraffic flow monitoringlog monitoringesxesxi monitoringnetwork discoveryswitch traffic monitoring
Easy Network Service Monitor

Shareware by Javvin Company
22 x 2500Kb downloads

...Easy Service Monitor is a network fault management tool that continuously monitors network devices...Web services: HTTP and HTTPs * FTP sites monitoring * Database Servers: Oracle, SQL, MySQL * Email...and IMAP4 * Telnet Server * Other TCP Services such as NNTP * UDP Services such as...Domain Name Service * Windows 2000/NT services * Monitoring of any network device with an IP address...
 
slanetwork monitornetwork managementfault managementnetwork applicationsservice level agreementnetwork troubleshootingservernetwork availabilitynetwork performance
Network Server Suite

Demo by Halcyon Software Limited
15 x 124937Kb downloads

...A comprehensive and highly functional package of monitoring and systems management tools, designed to provide maximum...availability of your servers and network devices. With Network Server Suite you can be in control of...your network from any location 24 hours a day, 7...
 
monitoringtoolsmanagementibmwindowseventreportingnetworkinfrastructureserverssystemslogsuite
Network Eagle Monitor Professional

Shareware by Extromatica
18 x 4609Kb downloads

Free Vista Files award
...Network Eagle Monitor Professional is a network monitor designed to inform you of network problems...managers do. You can monitor the network, servers, network services, hosts, devices, applications and databases. By running...recorded to a log file for future reference. Network Eagle Monitor Professional lets you get started right...SQL server via native interface, monitor local and network printers, and that`s just the beginning! You...
 
server softwarenetwork monitor softwareport monitoring softwareserver monitortcpip softwarediagnostic softwarenetwork management softwarenetwork server software
sMonitor

Shareware by Alexander Yarovy
21 x 5752Kb downloads

...a must-have for any business which provides online services to their clients or any other organization which...ensure the highest degree of reliability of their networked resources. sMonitor presents a server uptime monitor which...
 
udp portsserver uptime monitorport statusserver monitornetwork serversnetwork monitoringtcp portsnetwork servicesping
10-Strike LANState

Shareware by 10-Strike Software
46 x 9187Kb downloads

Free Vista Files award
...Monitor network hosts and services on a visual map. Get MAC addresses, scan...when devices turn on or go down. Create network diagram and watch your network state in a...network. Main features: 1. Modeling a local area network diagram in a visual mode and then saving...the result as a map with images. 2. Monitoring hosts (ICMP ping and connecting to TCP port...supported as well as 40 other checks and network protocols). 3.
 
networkmonitoringmappingtcpdeviceadministrator10-strikerebootscannermacrestartremotelanstatednsshutdownhostcomputerdiagram
...WebMail Spy includes an advanced, foolproof and secure monitoring system. All e-mail sent via OutLook, OutLook Express,...e-mail`s, and ALL web based e-mail - for services such as HotMail, Yahoo!Mail, mail2web, and many more....will be recorded. Aside from WebMail Spy`s powerful monitoring capabilities, WebMail Spy offers an advanced security backbone...
 
keyloggerhotmail spyspectoremail spy softwareexploreanywhereemail monitoringyahoo spyweb mail spyspybuddykey loggerwebmail spynetwork monitoringinternet spy
Nsauditor Network Security Auditor

Shareware by Nsasoft US LLC
56 x 10286Kb downloads

Free Vista Files award
...Nsauditor Network Security Auditor is the best network security scanner that allows to audit and monitor...remote network computers for possible vulnerabilities, checks your network for all potential methods that a hacker might...use to attack it. Nsauditor is a complete networking utilities package that includes a wide range of...tools for network auditing, scanning, monitoring and more. You can discover network services and...
 
network security auditingnetwork auditingnetwork security scannernetwork security auditornetwork auditor
Webserver Stress Tool

Shareware by Paessler AG
41 x 7868Kb downloads

Free Vista Files award
...Webserver Stress Tool simulates large numbers of users accessing a website via HTTP/HTTPS. The software can simulate up to 10,000 users that independently click their way through a...
 
server benchmarkload testingwebservertoolweb developernetworkmonitoringsystemweb servicesperformanceweb benchweb applicationhttpstress testing
Net Spy Pro

Shareware by Retina-X Studios, LLC
38 x 15420Kb downloads

Free Vista Files award
...Net Spy Pro is cutting edge network monitoring software. The program allows you to check-in one,...watch all users` actions in real time. Our Network monitoring software allows the administrator to view an...used for live surveillance to see if your network users are working or playing. The software can...the administrator a full list of processes and services running on the remote machine. A full list...
 
child monitoringstealthchatretina-xspyemployee monitoringyahoomessengerwindowsmyspacerecorderactivityretinaxspy softwaresurveillancewebsitefacebookemail