1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
137 x 26624Kb downloads

...it also provides various tools for Bandwidth Monitoring, Network Monitoring, Wake on LAN, Detect Rogue Devices in...Receiver and more. AdventNet ManageEngine OpUtils provides real-time monitoring tools to troubleshoot poor network performance, heavy bandwidth...The Standard Edition has 27 tools, which includes Network monitoring (Bandwidth Monitor, Network Monitor, Wake-on-LAN, Port Scanner,etc.)...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools
ManageEngine EventLog Analyzer Free Edition

Freeware by ZOHO Corp.
92 x 70656Kb downloads

Free Vista Files award
...Log Analyzer software, organizations can automate the entire process of managing terabytes of machine generated logs by...log analyzer software helps to mitigate internal threats, monitor file integrity, conduct log forensics analysis, monitor privileged...security threats and meet regulatory compliance requirements by monitoring and analyzing log data from all the network...
 
event log managementfile integrity monitoringsyslog managementagent-less log collectionwindows event logsevent log monitoringcompliance reportsevent log analyzersyslog monitoring
IP Traffic Monitor

Shareware by Skyward Software
32 x 7000Kb downloads

...are many reasons why you may want to monitor your Internet traffic flows. I`ll point out only...theft or using your computer as a peer-to-peer network hub for pirated software, music and video downloads...office, knowing the Internet traffic details becomes essential. Network load balance, security reasons and more... Recently I`ve...utility that serves just this purpose. IP Traffic Monitor sits in your system tray and monitors all...
 
networklanmonitoringtrafficuploadactivity
Protea AntiVirus Tools, ClamAV version

Shareware by Protea Tools
39 x 98353Kb downloads

Free Vista Files award
...per-recipient scans are performed. * The mail messages monitor can process multiple mail boxes. * Infected or...files are isolated in the quarantine zone, preventing network infection. * Optimized speed....
 
emailanti-virusclam-avhostilesecurityblockingquick healavastvirusbustertoolschecknsfprotectionserverutilitynotesantivirussoftwarelotusscananti virusdominoclamavquickhealclamwincontentfree
EF System Monitor

Shareware by EFSoftware
24 x 838Kb downloads

Free Vista Files award
...What the EF System Monitor is and what you can do with it:...network. * When you run the EF System Monitor under Windows except the Windows 9x you can...advanced services provided by these Windows platforms, like process and thread surveillance, advanced I/O port monitoring, CPU...that suggest their functions. * The EF System Monitor can not only show you the data from...
 
cpusystem monitormemoryefsoftwareefsysmon
Protea AntiVirus Tools, Avast! version

Shareware by Protea Tools
37 x 19779Kb downloads

Free Vista Files award
...per-recipient scans are performed. * The mail messages monitor can process multiple mail boxes. * Infected or...files are isolated in the quarantine zone, preventing network infection. * Optimized speed....
 
clam-avscanantivirustoolsclamavhostileblockingclamwinanti virusvirusbusterfreesoftwareavastcheckutilitycontentprotectionemailquick healdominoserversecurityquickhealanti-viruslotusnotesnsf
Network Configuration Management

Shareware by Missilesoft
30 x 3937Kb downloads

...Management is a set of utilities that manage network config, diagnose and monitor network, it includes: IP...speeds in a configurable, graphical display. Socket to Process Mapper: monitors all open TCP and UDP ports...
 
diagnosenetworkwhoisrecoveryprocesstaskmapperasterisksocketmonitormanagementpasswordmanagerconfigurationbandwidth
Free Vista Files award
...control of the Windows start up process, memory monitoring and gives you the power to customize desktop...used for both correctly removing software and for monitoring changes made to the hard drive, MS Windows...can also adjust applications initialized during the loading process of the operating system. Tweak UI - This...for greater stability of connection by changing hidden network settings. The Privacy - This is a kit...
 
professionalfixerutilitiesoptimizerstartupx86scanregvista64bitutilitywintoolscleanerultimatex64diskmechanicregistrytweakerwindowsram
StatWin Professional

Shareware by SXR Software
25 x 7818Kb downloads

Free Vista Files award
...StatWin Professional lets the user monitor and analyze statistics on computer performance and user...start and shutdown time, session and logged user; processes and applications running in Windows; installed and uninstalled...and other details. StatWin Professional also lets you monitor user activities and administer the system, even in...the stealth mode, so users of the monitored computer cannot suspect the presence of the monitoring...
 
printerscreenshotskeykeyloggerinternetstatwinsxrsoftprocessadminmodemnetworkmonitorprotectuser monitoringremotecomputer monitoring softwareemployeefile
NetWatcher

Shareware by Toleron Software
27 x 802Kb downloads

...Toleron Netwatcher is aimed for: *controlling the network integrity - both logical and physical; *monitoring the...carrying capacity of different network parts; *tracking status and response time of the...widely distributed network services (HTTP, SMTP, POP3, FTP etc.). Netwatcher was...usage of dynamically loaded modules (plug-ins), which gather network status information, process and display statistics as well...
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping
Web Link

Shareware by iNetPromoter
15 x 2929Kb downloads

...your own business network, you should protect your network from competitors. Web Link will notify you when...you and your partner. Web Link also helps monitor your competitor`s back links allowing you and your...to request back link from link partners. Automatically process answers from your link partner. Tree-Layout makes managing...back links easily. Monitor the status of Back Links and send Email...
 
linkwebpageexchangereciprocalgooglepopularitymonitordefenserank
Protea AntiVirus Tools, Quick Heal version

Shareware by Protea Tools
35 x 3649Kb downloads

...per-recipient scans are performed. * The mail messages monitor can process multiple mail boxes. * Infected or...files are isolated in the quarantine zone, preventing network infection. * Optimized speed....
 
antivirusnotessecuritysoftwarevirusbusteranti-virusblockingutilityclamclamwinnsfmailemailanti viruscontentfreedominoclamavlotushostileavastscanclam-avquick healprotectionserverchecktoolsquickheal
...NETObserve is a sleek, powerful remote administration and monitoring solution for home and business environments. NETObserve allows...or outside a network) and moderate, administrate, and monitor the machine`s activity. NETObserve`s remote administration features include...system browsing, file transferring, registry key editing, startup process moderating, favorite place viewing, open port and connection...
 
spy softwareremote computer monitoringkeyloggerweb based administrationexploreanywherekey loggerremote administrationnetwork adminnetwork surveillanceremote spynetwork monitoringspyanywhereremote computingnetobserve
Nsauditor Network Security Auditor

Shareware by Nsasoft US LLC
56 x 10286Kb downloads

Free Vista Files award
...Nsauditor Network Security Auditor is the best network security scanner that allows to audit and monitor...remote network computers for possible vulnerabilities, checks your network for all potential methods that a hacker might...use to attack it. Nsauditor is a complete networking utilities package that includes a wide range of...tools for network auditing, scanning, monitoring and more. You can discover network services and...
 
network security auditingnetwork auditingnetwork security scannernetwork security auditornetwork auditor
TaskInfo

Shareware by Igor Arsenin
29 x 2878Kb downloads

Free Vista Files award
...Manager and System Information. Show most of the processes that are often invisible such as keyloggers and...Kernel Drivers, Provides real time info on all processes and threads including System threads. Shows TCP/IP Connections....
 
informationopenmemorysystemmoduleprocessusagewindowscpudebuggervistadllthreadfilemanagermonitorhandletask2000tuningtaskmgr
LinkAlertPC Extended Edition

Shareware by InBloom Products
19 x 4886Kb downloads

...LinkAlertPC Extended Edition monitors the availability and performance of your organization`s servers,...workstations, network devices and more. Monitoring is extensive and proactive - links/devices that fail...Https, Printer, Service, Stock, UDP/IP, Time, Reminder, Telnet, Process and Events. Actions - Status, Free Space, Open...Extensive event control includes Start, Stop and Resume monitoring of one or more links. A Test facility...
 
tcplinkalertpcservicenetworktelnetnotificationfilefoldermonitorlanibpeventftpreminderdiskinbloomudpprinterprocessemailhttps
X-NetStat

Shareware by Fresh Software
43 x 441Kb downloads

...that displays information on your current Internet and network connections, much like the console netstat.exe program, but...message, check your email, or anytime you do network activity that requires you to connect to another...long the connection has been active, and the process EXE * behind each connection....
 
statsudpport monitorfirewallsnmptcpicmpnetworkx-netstatwhoistrojanconnectionshackerxnsfinwaittracerouteserverestablishedkillfinger
Free Vista Files award
...DEKSI Network Monitor is an advanced, powerful, and multi-featured network device...or out of service. This will enable the network administrator or IT Management staff to be pro-active...in responding to any possible downtime. DEKSI Network Monitor periodically polls devices a the network map and...shutting down a service or a computer. DEKSI Network Monitor scans a local area network and automatically...
 
website monitoringnetwork monitornetwork device monitornetwork monitoringnetwork monitoring softwareserver monitortcp monitornetwork administrationnetwork managementport monitorserver monitoring
Task Administrator

Shareware by Saturn7
20 x 885Kb downloads

...Remote process monitor with Alert function and advanced process analyse. Allow lookup remote computer process list, realtime...data filter. Enable 4 process group by right. Windows domain or windows workgroup...based network is required. Allow monitor computers throw the internet (Administration access is required)....
 
windows domainmonitoringremote processadministratornetworkwindows workgroup

Freeware by NRG Global
16 x 8073Kb downloads

...CleverEye Suite monitors form six perspectives NodeWatch Monitor availability and response time of your servers, routers,...switches and other systems from the network layer perspective. Monitor via ICMP/ Ping check and...Web servers, Mail servers (SMTP, IMAP, POP3). TaskWatch Monitor response time of your applications by executing user...- Custom Test: run your own scripts SNMPwatch Monitor SNMP enabled devices: printers, routers, switches,...
 
network monitoringserver uptimesystem monitoringwebserver monitoringfile monitoringdatabase monitoringcitrix monitoring softwareavailibility monitoringavailability monitoring