Sort by : ReleasedNameDownloadsAddedRatingRelevance
Bandwidth Vista

Freeware by Bandwidth Vista
927 x 17000Kb downloads

Free Vista Files award
...2 runs quietly from the system tray displaying network activity while you work or you can show...
 
bandwidthvistameterfreesoftwarenetworkmonitoring
Firefox

Open source by Mozilla
619 x 5700Kb downloads

...JSON
* MathML
* Animated Portable Network Graphics (APNG)
* Cross-Site XMLHttpRequest
*...
 
thunderbirdmozillabrowserfirefox
StrongDC++

Freeware by BigMuscle
522 x 3500Kb downloads

Free Vista Files award
...Main benefits of StrongDC++ * Safe segmented downloading Download one file from more users simultaneously without corruption! This way of downloading dramatically improves download speed, especially for fast connections, and it`...
 
peer peersharing
! - A+ PC Error Eliminator

Shareware by PC Max Software
9 x 675Kb downloads

...postpone the purchase of a new machine, a network administrator/computer consultant who investigates and corrects performance problems...
 
tuneupwallpaperoptimizerstickypadspywareprivacydeletepopupmemoryautorun
#1 Atomic Clock

Demo by www.freefileszone.com
30 x 488Kb downloads

...atomic clock (time server). It uses a high-precision network time protocol (NTP) which provides accuracy of several...on the characteristics of the synchronization source and network paths. Features: Skinned, Work as Time Server, Synchronize...
 
dailysynchronizationinternetatomic clocksntpnistsynchronizesynchronic
...duplicate files on your local computer or computer network (vista supported). Your hard disc is normally occupied...Window. * Search within Zip Archives. * Supports networks and removable media devices like (external hardisk, flash...
 
check duplicateduplicate filessearch duplicateclone filesidentical filessame filesduplicate check
#1 Free PC Inventory Software

Freeware by 1Smart Soft
31 x 365Kb downloads

...can create a full list of all your network drives and display the MAC addresses of all...your network devices, ideal if you are configuring your network....
 
inventory software
.NET DNS Component for CS VB ASP.NET

Shareware by ComponentForge
3 x 3983Kb downloads

...NetXtremeDns .NET component offers a number of classes that make the work of querying DNS servers for resource record types defined by RFC-1034 and RFC-1035 more easily. You...
 
nsaphinfoisdnnullrequest messagenxtnet componentdomain name serverresource recordsquery dnsminfogposafsdbcnamekeydns servernsapptraaaa
.NET FTP Library

Shareware by Kellerman Software
2 x 3634Kb downloads

...component is so robust you can remove the network cable, put it back in, and the transfer...
 
componentftplibrary
.net PortObserver

Shareware by STEITZ IT-Solutions
15 x 2075Kb downloads

...a ver powerful, and intuitive - easy-to-use - network monitoring tool. It monitors network traffic, network access,...bandwith, access from the network to files on your system....
 
observing portschange mac addressmonitor traffic

Shareware by ComponentPro
1 x 3022Kb downloads

...name * Performing Internet Route Tracing to determine network delays and topology * Performing domain registration lookups...
 
net dnsiplookupnet componenttracertproxy
.NET SFTP Library

Shareware by Kellerman Software
4 x 5733Kb downloads

...you can actually unplug you PC from the network in the middle of a transfer, plug it...
 
sshlibraryvbnetcomponentsftp
.NET Traceroute Component for CS VB ASP

Shareware by ComponentForge
3 x 4815Kb downloads

...methods to perform Internet route tracing to determine network delays and topology....
 
packetnet componentpublic time serverinternet timesynchronize timedotnet componentsntptime synchronizationrfc-1305communicationframeworkatomic clockrfc-868exact timeclass libraryprotocolrfc-867
001Micron Website Monitoring Tool

Shareware by Data Restore
5 x 1331Kb downloads

Free Vista Files award
...found, server not found, connection failed, low connectivity network status, low bandwidth etc....
 
webpageutiltiynetworkmonitordowntimeping statusseek timeonlineremoteavailabilitymethodwatchofflinetrackerwebsitecheckerperformancesoftwareuptimerealtimeweb based application
Free Vista Files award
...status of sites, remote hosting server, web host network and network availability. Website status tracker tool instantly...not found, low bandwidth, connection failed, low connectivity network status etc. Free download web page monitoring program...
 
utilityuptimesoftwaresmtpftpnetworkperformancepop3notifycheckeralertwebsitesupportconditiontoolmonitoringtrackerdowntimeping statusserverhttpsreal timeweb based application
024h Lucky Reminder

Shareware by 024h Software
16 x 690Kb downloads

...yearly and custom recurrence), sound alarms, pop-up reminders, network synchronization, and much more. Please visit our website...Share events with other users of local area network using network synchronization; - Customize program interface; -...area network. keywords: daily reminder tool free remind network software weekly alert utility event organizer program network...
 
applicationreminderdailynetworkplannerdesktoptoolsoftwareweeklyorganizer
0S Non-Proxy Atomic Sync

Shareware by Brigsoft
15 x 761Kb downloads

Free Vista Files award
...A standard synchronizing program will not work if NTP (Network Time Protocol) is suppressed by a proxy or a firewall. This synchronizer uses plain access to WWW pages that show...
 
utilitysntphttpprogramwindowssynchronicsynchronizeatomicvistautilitiesdailytoolsclockinternetnistsynchronization
...1 Click Encrypt is a highly secure encryption utility that brings military strength encryption power at your fingertips, assuring that your files, folders are secured and protected from intruders and...
 
encrypt emaildiskemail securityeasyfilesystemsecurewipetransparentfile encryptiondata securityprivacysafefile securitysecretcryptographicprotect documentsprotectionalgorithmcypher keyencryption software
...disk directories including ZIP and RAR archives and network folders. Thus, using Clone Remover you receive the...
 
filesduplicatedelete
1 Firewall

Shareware by Spy-Kill.com
11 x 988Kb downloads

...for your Windows computer, that can monitor your network activity, block and alert you about unathorized publishers,...exploits, Trojans and backdoors, using a low level network traffic filter. It also gives you the possibility...
 
firewall