Sort by : ReleasedNameDownloadsAddedRatingRelevance
PingerThinger

Shareware by PingerThinger.com
22 x 188Kb downloads

...PingerThinger is a ping-based network monitoring tool that tracks which IPs on your LAN / WAN are not responding. PingerThinger provides at-a-glance network status and a window listing...
 
website monitoringnetwork monitoringnetwork healthping
...Monitor large and medium networks without leaving your chair! Network Monitoring Probe looks after your LAN no matter how large, raising alerts automatically if certain events occur. Watch network performance...
 
network monitoringnetwork managementmonitor network
Little:eye Lite

Commercial by CBR Software
25 x 70996Kb downloads

...CBR little:eye Lite, which is developed for management of IT infrastructure of enterprise and provides management of fault, performance, inventory and configuration is the closest assistant of system administrators...
 
inventory managementbandwidth monitoringsyslog deamonsnmpnetwork monitoring
Alchemy Network Monitor

Shareware by M.I.S.Helpers
24 x 5898Kb downloads

...Alchemy Network Monitor monitors your network servers and business-critical applications availability and performance and immediately alerts you if a server gets out of order. Alchemy Network Monitor can also...
 
network monitorserver monitortcpip softwareserver softwarediagnostic softwarenetwork monitor softwarenetwork server softwarenetwork management softwareport monitoring softwarenetwork monitoring software
DnsEye

Freeware by Nsasoft US LLC
68 x 478Kb downloads

...DnsEye is monitoring network traffic by capturing Domain Name System DNS packets in network and displays the host names resolve information. The program allows to monitor requested URLs in network,...
 
network softwarenetwork toolnetwork monitoringdnsnetwork utilsnet toolsfreeware software

Freeware by Tools4ever
24 x 1152Kb downloads

Free Vista Files award
...Free network disk usage monitoring for Windows servers and workstations. Automatically scans your network for disks and adds them to your monitoring dashboard. Smart scheduling minimizes network load. The monitoring...
 
disksoverviewmonitoringtools4eversoftwarefreereportingsizeutility
...Centrolized company-wide employee pc activity monitoring solution, monitor 3000+ network computers within one server. Employee Monitoring Software is an application for real time network computer monitoring and content filting,...
 
monitor employeesemployee monitoringemployee monitoring softwareemployee computer monitoring
FreeSnmp

Freeware by Nsasoft US LLC
51 x 577Kb downloads

...Free SNMP is mib browser and SNMP monitoring and management software. The software provides basic support for Simple Network Management Protocol (SNMP), allowing users to perform such tasks as viewing...
 
snmp clientsnmp managementnetwork utilsnet toolsnetwork monitoringnetwork softwaresnmp mib browsersnmp monitoringsnmp discoverynetwork tool
...DEKSI Network Monitoring Suite is a set of three award winning network software tools that allow you to monitor devices and servers on your network, obtain online data when the...
 
server monitorbandwidth monitoringbandwidth analyzernetwork monitoringnetwork device monitornetwork mapping
LanTopolog

Freeware by Yuriy Volokitin
97 x 824Kb downloads

...LanTopolog is a freeware application that provides physical network topology discovery, visualization and monitoring Key features: - Automatic physical network topology discovery based on SNMP - Provide detailed and searchable physical network...
 
network monitoringtopology discoverynetwork mapautomaticnotifyinglanstatevisualizationphysicalalarmmacfreewareutilitynetwork visualizationnetwork monitoring toolsaddresssnmpnetwork discovery
Alchemy Eye PRO

Shareware by Alchemy Lab
17 x 6063Kb downloads

Free Vista Files award
...Alchemy Eye PRO is a system management tool that continuously monitors server availability and performance. In the event of network errors, Alchemy Eye can alert the network administrator by cell...
 
network managementnetwork utilitiescomputer networkingnetwork monitormonitoring softwarebandwidth monitornetwork monitoring
VE Network Catcher Lite

Freeware by Shunra Software LTD
36 x 409Kb downloads

...Shunra`s VE Network Catcher Lite is a free, standalone network monitoring tool that records and displays latency and packet loss between your PC and any internet site. This freeware...
 
network catcheremulationtestingcapacitysimulationconfigurationsecurityjitterinternet monitoringsoftwaretrafficdesignpingrecordinglatencybandwidthperformanceapplicationservershunra
IPAppmon

Demo by IP Worx
19 x 4592Kb downloads

...Are you an over-worked network administrator? Get calls complaining about system outages you have no way of monitoring? Don`t know if your payroll server is up or down?...
 
monitorapplicationwhatsnetworktcpipserveralive
Alchemy Eye

Shareware by Alchemy Lab
21 x 5899Kb downloads

Free Vista Files award
...Alchemy Eye is a system management tool that continuously monitors server availability and performance. In the event of network errors, Alchemy Eye can alert the network administrator by cell phone...
 
bandwidth monitornetwork managementmonitoring softwarenetwork utilitiesnetwork monitoringcomputer networking
IPHost Network Monitor

Shareware by IPHostMonitor
33 x 52878Kb downloads

...IPHost Network Monitor is a stable distributed network and server monitoring software. This tool allows monitoring of websites and intranet applications, mail, database (Oracle, MySQL, MS SQL, ODBC) servers, network...
 
pingbandwidth monitordatabase servernetwork monitoringmonitoring softwareoraclemonitoring toolsnmpdistributed monitoringnetwork traffic monitoringmysqlhttpwmiserver monitoringinternet hostnetwork resources monitor
...Monitor large and medium networks without leaving your chair! Total Network Monitor looks after your LAN no matter how large, raising alerts automatically if certain events occur. Watch network performance...
 
free network monitornetwork monitoringnetwork managementmonitor network
Alchemy Network Monitor PRO

Shareware by M.I.S.Helpers
22 x 6064Kb downloads

Free Vista Files award
...Alchemy Network Monitor monitors your network servers and business-critical applications availability and performance and immediately alerts you if a server gets out of order. Alchemy Network Monitor can also...
 
port monitoring softwaretcpip softwareserver softwarediagnostic softwarenetwork monitor softwarenetwork server softwareserver monitornetwork management software
Server Nanny Network Monitor

Shareware by Xenos Software LLC
15 x 5575Kb downloads

...Reduce downtime and be the first to know when a server or network device fails by using Server Nanny network and server monitoring software. The last time you had a...
 
network monitoring softwareserver monitoring softwareweb server monitorserver monitoring tool
System PulseMeter

Shareware by System Pulse Software
16 x 13474Kb downloads

...System PulseMeter is a comprehensive network monitoring software designed for easy system and network monitoring: get a centralized insight into the monitored IT infrastructure using network map. Monitor network performance,...
 
testdiskwindowsnotificationnetwork management softwareservicedevicesoftware network monitoringhost monitoringprocessnetwork monitoring toolnetwork monitoring softwaretrafficwmi
IPHost Network Monitor Freeware

Freeware by IPHostMonitor
17 x 52878Kb downloads

...IPHost Network Monitor is a freeware network and server monitoring software. The free version allows monitoring of websites and intranet applications, mail, database (Oracle, MySQL, MS SQL, ODBC) and other...
 
distributed monitoringoraclehttpsnmpnetwork resources monitoringfree monitoring toolfree monitoring softwarefree server monitoringmail serverftphttpswmipingmysqldatabase serverodbc