Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
452 x 1719Kb downloads

Free Vista Files award over the Internet ! The Internet Broadcasting Server is a software package composed of two programs:...a potentially large audience, using a standard web server as a bandwidth amplifier. All you need The disk space used in the web server is always less than 5 MB, even if...broadcast by setting user-based passwords with your web server htaccess files....
XP Lan Pro

Freeware by Apnasoft Technologies
220 x 2021Kb downloads

...your computer, MAC address of LAN card, Host Name Determination, Subnet Mask of your network, DNS Server,...
network informationxplanpro
Scannet Pro

Shareware by Profiler3d
294 x 11118Kb downloads

...of connections over a number of individual WHOIS servers including the X500 NASA server.The HTTP module offers...of available LAN-Objects by giving object, type, local name and Network-term.The module checks in individual programmable timeperiods...
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by Adiscon GmbH
78 x 100Kb downloads

...Adiscon logger is an UNIX-like logger command line tool for Windows. It is a re-write of the UNIX logger tool with enhanced functionality. All the popular UNIX options...
syslogwindowsunixlinuxcommand linelogger

Freeware by VitalTech Group
199 x 756Kb downloads

...VitalTech IPCalculator is an easy-to-use IP subnet calculator that lets you to calculate every aspect of your subnet configuration in a few mouse clicks. It takes an IP...
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads remove spam emails just from the mail server without pulling them down into your Inbox. SPAM...
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Paessler URL Recorder

Freeware by Paessler AG
91 x 740Kb downloads

...strings that a user sends to a web server while surfing a sequence of URLs. It works...
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...files or whole web sites from any remote server via HTTP, HTTPS, FTP and BitTorrent up to...
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL SERVER, ORACLE, DB2, SYBASE, MYSQL, FIREBIRD and others. In addition, it also...
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from three licenses: a useful FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest...
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
Time Zones Clock

Freeware by Galleon Systems Ltd
177 x 362Kb downloads

...Running on your PC Time Zone Clock will show you the local time of over 300 cities around the world. Simply select the cities you want to display the local...
rugby time serverclocktime zonesntp time serveratomic clock

Freeware by LCPSoft
235 x 2340Kb downloads

...Password auditing and recovery tool for Windows NT/2000/XP/2003. Accounts information import: import from local computer, import from remote computer, import from SAM file, import from .LC file,...
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
internetutilitiesmail headermail headers
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
136 x 26624Kb downloads

...(Bandwidth Monitor, Network Monitor, Wake-on-LAN, Port Scanner,etc.) and Server monitoring tools (Disk Space Monitor, CPU Monitor, Process...
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools

Freeware by Carson E. White
147 x 26119Kb downloads

...genealogy software for building family tree s using a skeleton model starting at the current century backwards to AD or beyond. Includes charts and Grids that are all printable. And...
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...application monitoring. Applications Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...Oracle, SQL Server, Sybase, PostgreSQL, memcached and DB2. Server Monitoring involves monitoring of Windows, Linux, HP-Unix, Tru64...monitoring.
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
InstantCharts Messenger for Traders

82 x 2082Kb downloads

...InstantCharts Instant Messenger for Traders, this free software gives you an access to market data which is represented by tickers, quote lists, news and charts. A very useful tool for...
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...used with any web hotel, no matter what WebServer the web hotel uses. Unlike common CMS tools,...
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing