Sort by : ReleasedNameDownloadsAddedRatingRelevance
XP Lan Pro

Freeware by Apnasoft Technologies
220 x 2021Kb downloads

...Pro 3.3 (Beta) can determine following things. IP address of your computer, MAC address of LAN card,...Host Name Determination, Subnet Mask of your network, DNS Server,...Lan Pro it shows you Total bytes sent and Total bytes recive....
 
network informationxplanpro
Scannet Pro

Shareware by Profiler3d
295 x 11118Kb downloads

...Network Monitor,Intern Firewall.Trace route,Shows release,Lists devices and network services,observing network release,observing all ports,direct access on...all network releases in LAN,WAN and Internet.Online database for ports ore IP adress location.observing...of exchange programms like Kazaa or Emule, Netmeetings and chatsystems like ICQ and Yahoo.It shows exact Windows...coding technology .
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate...web collaboration client along with integrated BitDefender anti-virus and real-time Commtouch RPD anti-spam protection. The included web...folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a rich browser-based interface....
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by VitalTech Group
199 x 756Kb downloads

...a few mouse clicks. It takes an IP address and netmask and calculates the resulting broadcast, network,...Cisco wildcard mask, and host range. It is also intended to be...a teaching tool and presents the subnetting results as easy-to-understand binary values....The maximum possible number of Subnets and Hosts are calculated for a given IP network...class and the number of subnet bits. The binary representation...
 
networkmaskbitsubnetserversolvecalculator
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It can check your...mailbox and parse through messages looking for delivery failures, subscribe...requests, and unsubscribe requests. When PopMonger finds a matching message...it can add the sender`s address to a list along with a date and...optionally mark a message for deletion after processing, and leave unmatched email in your mailbox to check...another mailbox.
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
SMSCOUNTRY SMS Mail Box

Freeware by SMSCOUNTRY
392 x 2744Kb downloads

...You can send sms from Microsoft® Outlook® and it is as simple as sending an email....2000, 2002, 2003 versions. Features: 1. Use existing address book contacts from Microsoft® Outlook®. 2. Simultaneously broadcast...
 
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
137 x 26624Kb downloads

...physical location. It automatically retrieves the VLAN details and can be run at scheduled interval. The IP...automatically discovers the subnets from the routing tables and scan them periodically to get the details of...Used & Available IP Address in your network. In addition to IPAM &...Port Mapper, it also provides various tools for Bandwidth Monitoring, Network Monitoring, Wake on LAN, Detect Rogue...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools
VoIPerized

Freeware by Jeroen de Kleijn
155 x 316Kb downloads

...VoIPerized is a so called VoIP (Voice over IP) program. VoIPerized enables you to make free audio calls to other people who also run VoIPerized. When making VoIPerized the focus...
 
upnplow latencyspeexinternetcommunicationsvoiperizedconferencevadhigh qualitytelephonyvoice overchattelephonefreewareaudio
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...remote blacklist filter (DNSBL), a delay filter, whitelists and blacklists to a filtering configuration that exactly suits...service from flooding or directory harvest attacks. Recipient addresses can be checked while a message is submitted,...you have online access to view statistics charts and reports in real-time using a web browser, or...(a listing of mails received, including subject, sender and recipient address), and a ranking of spam hosts...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
589 x 14208Kb downloads

Free Vista Files award
...The email program you already use for sending and receiving messages can be connected to the server...while sending, it establishes dozens of SMTP connections, and gets the most out of your Internet connection....Advanced SMTP Server is able to send thousands of emails per minute with a regular DSL...
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
GooPR

Freeware by TM Services
61 x 0Kb downloads

...Put the web address into the field, press Enter, get Google result....result you will get the Google pagerank value and web site position in Google directory. It`s very...
 
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank
...Never loose information again. With its ergonomic design, and automatic hyperlink recognition, NoteIT gives you seamless access...to a calculator, text-to-speech reader, Web search results and any of your notes quickly, allowing you to...backup, archive, search, print, password protect, hear and email your notes easily and fast. NoteIT was...designed to be fast and to make it highly unlikely for users to...
 
free softwarefreewareipodpimsresearchnote takerfree skinsarchiveaddress booknoteitorganizercalculatorreadernotestext-to-speechapple
PhraseExpress Text Expander

Freeware by Bartels Media GmbH
134 x 3803Kb downloads

Free Vista Files award
...Autotext Text Expander and Boilerplate Template Manager for Windows. PhraseExpress manages frequently...used text snippets for quick access and eliminates repetitive typing with the text replacement feature....Boilerplate templates can be stored together with bitmaps and Microsoft Word-, RTF- or HTML text formatting. The...prediction feature watches out for repetitive text patterns and offers to auto-complete such phrases. Smart algorithms analyze...
 
abbreviationabbreviationsautotextsphrasessignaturessnippettypingautocompleteshortcutshortcutsclipboardsnippetspredictivehotkeyautocorrecthotkeys
Cayman Browser

Freeware by caymanbrowser.com
77 x 1677Kb downloads

...open multiple web pages at the same time, and more: *Website status: View Google PageRank, Alexa traffic...ranking, Alexa related links and backward links from Google, Yahoo! and MSN -...*Incredible Search: Includes more than 500 search engines and 100 search categories *Flash animation filter: Block all...scan: Check all Urls in a web page and show each url`s create date, file size, link...page (includes up to 35 languages).
 
webbrowser
DNS4Me

Freeware by RhinoSoft.com
180 x 2715Kb downloads

Free Vista Files award
...you need something to associate a static domain name with it to make it easier for visitors...well as a layer of contact between you and your Web site. This gives you unparalleled control...over its configuration, content, and delivery. But the benefits of dynamic DNS aren`t...service that can make use of a domain name can benefit from DNS4Me. This includes FTP servers,...
 
domainddnsdynamic dnsaddressstatic
SimpleDesktop

Freeware by Moog Software
134 x 18000Kb downloads

Free Vista Files award
...SimpleDesktop provides fast and easy access to a remote computer. It`s unique...breeze. Complete strong session encryption ensures your privacy and HTTP proxied connections allow access in even the...most restrictive networks. Server and router IP address upload ensures long term remote access even on...DHCP dynamic-ip internet connections and the browser accessible server allows a quick download...
 
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator
Subscribe Emails

Freeware by IM-Soft
73 x 609Kb downloads

Free Vista Files award
...with the requests to your computer, get email addresses and sender names from them and create text...with any bulk mailer to add new subscribers and delete existing subscribers. The program is optimized for...working with Bulk E-Mailer mass mailer, and although Bulk E-Mailer has a built-in file and...email subscribe and unsubscribe feature, Subscribe Emails gives you more freedom...
 
mailingmassemailaddresse-mailfreemailerbomberremailerbulksmtpbook
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...useful for laptop users traveling around the world and connecting their PCs to different Internet Service Providers...of ISP`s SMTP server to increase your security and privacy. Free SMTP Server supports all email programs...like Outlook Express and Eudora, but best optimized to work with Outlook...The email program you already use for sending and receiving messages can be connected to the server...
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
Alarm Me

Freeware by Qytec
211 x 997Kb downloads

...organizer as it is powerful, regarding its capabilities, and its user interface is great. Includes general alarms,...repeating alarms, perfect Birthday reminder, Address Book facillity, build in Diary and more. It...contains Timer and Countdown utility. Also it supports the "shut down...log off) your system. Its Simplicity to use and its several capabilities make "Alarm Me" to be...
 
remindershutschedulecountdowndiaryshutdownalarmrestartaddresstimercalendar
...category driven product catalog with highly customizable styles and powerful features, without any technical skills. Catalog contain...special view graphics, magnified view, graphic zooming option and many more features, to provide rich and expressive...works as photo album maker. User can customize and configure catalog contents, theme and design setting to...suit its industry and campaign. User need not to depend upon external...
 
free slide show builderfree catalog builderfree catalog softwarefree photo album softwarefree web catalog makerfree catalog maker