1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
DBDesigner 4

Freeware by fabFORCE
688 x 7365Kb downloads

...ERwin© and theKompany`s DataArchitect© but is an Open Source Project available for Microsoft Windows© 2k/XP and Linux...4 is developed and optimized for the open source MySQL-Database to support MySQL users with a powerful...and free available design tool. All MySQL specific features have been built in to offer...design and keep control of your MySQL-Databases. The source code of the DBDesigner 4 is available at:...
 
designerdatabasemysqlfabforcesourcedbdesigner
...for you to change any ASP or HTML code ATAF-support is also available in a version for...
 
databasesource codeuser supportatafiis40chilliiis50asp
...a MS-Access database and create it on a mySQL server in one of the 4 following ways...are connected to the same network as your mySQL server, you can convert the database design directly...to the mySQL server, and then copy the all the database...database from the ATAF-CON application to your ISP`s mySQL server. If your ISP does not support ATAF-CON,...MS-Access database and data in converted to the mySQL server. No need to make any SQL code...
 
ccrdkconversiondevelopmentconstructionprogressas400tableeasyodbcformulasourcelotus notesfieldcodedevelopingkeyms-accessdb2htmlaccesstoaspformconvertmysqlatafbiz
Database Manager

Freeware by Inner-Smile.com
35 x 816Kb downloads

...Database engine or the Advantage TDataSet descendant or MySQL tables. Supported functions are: Table creation (generates table...creation source code for BDE engine, Apollo driver, Advantage driver), converts...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
dbForge Fusion for MySQL

Shareware by Devart
14 x 49931Kb downloads

...dbForge Fusion for MySQL is a powerful plugin designed to simplify MySQL...The tool provides an easy way to manage MySQL connections. When integrated with Visual Studio, the plugin...2012 / 2013 / 2015. dbForge Fusion for MySQL works with any MariaDB database servers, and supports...2012, 2013, 2015 - Integration with dotConnect for MySQL - MySQL Connectivity: * Support of all MySQL...
 
database toolproject supportmariadbdevelopmentmysqldebuggerstored programcode completionquery builderide extensionmanagementadd-inexportimportsql editorvisual studio
...element of your application from user interface to code is provided inside of a single seamless experience....an Access database or any other ADO data source Protara let`s you design, edit, and bind to...color coding, auto-complete, call tips, function lookups, and code folding. Built from the ground up for compatibility...
 
developerformsdatabaseprotaradesignjavascriptrapid application developmentdebuggerbuild applications
...Would you like to know how to create MySQL client applications using Visual C++ with MySQL C...API? What is MySQL? The MySQL database server is the world`s most popular open...If you are looking for a full example source code for a complete MFC C++ program that...uses the MySQL C API to access a MySQL database, then this package is for you. MyBooks...
 
mysqlmfcapiclient
...Would you like to know how to create MySQL client applications using Visual C++ with MySQL++ class...library? What is MySQL? The MySQL database server is the world`s most popular open...If you are looking for a full example source code for a complete MFC C++ program that...uses the MySQL++ class library to access a MySQL database, then this package is for you. MyNotes...
 
mysqlmfc
Free Vista Files award
...ASPMaker is a powerful ASP code generator that can generate a full set of...Microsoft Access Database, SQL Server or any Data Source that supports ADO. Using ASPMaker, you can instantly...applications that best suits your needs. The generated codes are clean, straightforward and easy-to-customize. ASPMaker can save...
 
generatorhtmlaccesswebmicrosoftdatabasepagessqlscriptgenerateaspodbcoracleservermysqlcode
...html content, custom emoticons. The package comes with source code for the server side php files and...
 
webcammessagessupportvideodatingcamerap2pinstant messengerserverframesemoticonschat
1-abc.net WebDynamicer

Shareware by 1-abc.net
16 x 110Kb downloads

...of a database using technologies like PHP, Perl, MySQL and others and allow webmasters and editors to...for this! Just add some comments to the source code of your website and put changeable parts...Headline changes, international websites, re-branded mirror web pages, outsourced text design without delivering the source code to...identifiers for comments in HTML, PERL or PHP source code // Unlimited file import - your disk...
 
conversioncmsgoodtranslatestaticalphpdynamicalconfigurecontent management systemfasteasyhtmlwebpagesbatch modeexchangedynamizeexchangablewebsitessource codesaveperlconvert
Collection of Delphi Examples

Shareware by Delcode.com Software
40 x 4427Kb downloads

...Collection of most wanted Delphi examples with full source code and animated tutorials as a standalone application....
 
source codebeginerreportsravemysqlexamplesdelphireportingprogramming tutorialcustomtutorialsdbexpressformsdatabase
...real world application that shows how to use MySQL with PHP. You can learn from the step...by step commented php source code how to build a php program that uses...If you are looking for a full example source codes for a complete PHP program that shows...a html form 4. How to separate php code from html and css files 5. How to...to use php include files to avoid unnecessary code duplication 7. In php functions, how to use...
 
mysqlphpdatabasebooks
AppGini PHP Code Generator For MySQL

Shareware by BigProf Software
27 x 10709Kb downloads

Free Vista Files award
...cost and time, and rest assured that your code will be fully functional and bug-free. AppGini converts...a powerful multi-user PHP application that connects to MySQL database. It creates HTML forms for editing your...
 
internetwebintranetscriptmysqlcodemulti-userfrontendsourcewindowsphpcreatedevelopapplicationdatabasegeneratelinuxautomate
MSSQL to MySQL Converter

Shareware by Interface Computers
12 x 12305Kb downloads

...MSSQL to MySQL Converter is a tool to Convert, Migrate data...from MS SQL Server Database to MySQL Database or from MySQL to MS SQL Server...in one go from MS SQL Server to MySQL or from MS SQL Server to MySQL database....While converting you can map source table columns to matching destination table columns. Filter...rows by specifying WHERE conditions. MSSQL to MySQL Converter comes with a built in scheduler so...
 
convertmssql mysqldatabasesmigrateimportconverterexport
TRegistration

Shareware by 3delite
27 x 3737Kb downloads

...with which you can handle and manage the MySQL registration database (comes with full source code). -...
 
usermysqlfreeregistratorsdatabasesharewareregistrationversioneditcomponentprojectssubversionregisterdelphiregistrantslocalizationcommercial
Shop-Script FREE

Freeware by WebAsyst LLC
40 x 385Kb downloads

...- Quick & Simple setup - Powered by MySQL - 100% open source code - Works on...
 
free shopping cart softwarefree php shopping cartshop-scriptpaypal shopping cartfree php cart
SQL Code Library

Shareware by OverZone Software
29 x 12078Kb downloads

Free Vista Files award
...SQL Code Library is a powerful multi-language source code Library with the following benefits: 1. Built-in library...with 50,000+ lines of code 2. Quick and powerful search engine 3. Powerful...
 
sqlsource codesourcebookmysqlcode snippet managersource code librarycode librarianoracledatabase
OpenDomains

Freeware by TGM Hosting
39 x 664Kb downloads

...with any hosting linux, windows ( PHP / MySQL ). Create subdomain, short domain, domain redirect, with...
 
domain redirectfree domain nameopendomainsfree short domainphpfree subdomainmysql source code
Code Warehouse

Shareware by Xcca Inc.
20 x 2444Kb downloads

...you found a lot of useful pieces of code snippets which can be reused in your applications....there are no any structure. Here comes the Code Warehouse. Features For all developers: Structure and organization...of your code snippets; Support of most popular databases: SQL Server,...
 
snippet librarysource code organizersnippet managerxccacomsource code managercode reusecode librariancode librarysnippet librariansnippet organizersource code snippetcode warehouse