1 2 3 4 5 6 7 8 9 ... 23 24 25 26 27 28 29 30 31 32

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL...any database. You can create or modify the database template to customize everything! So this SQL tool...you work more efficiently. It has many features. Database template: add/remove database object which showed in database...schema tree or code completion list.Customize database object pop menu.
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...single integrated monitoring tool suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and...WebSphere Monitoring, J2EE Web Transactions and Java Runtime. Database Management feature accelerates the detection, diagnosis, and resolution...of business-critical database performance issues before they affect end-users. It notifies...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
DBDesigner 4

Freeware by fabFORCE
688 x 7365Kb downloads

...DBDesigner 4 is a visual database design system that integrates database design, modeling, creation...optimized for the open source MySQL-Database to support MySQL users with a powerful and free available design...tool. All MySQL specific features have been built in to offer...
 
designerdatabasemysqlfabforcesourcedbdesigner
RapidSMTP Free Edition

Freeware by RapidSMTP.com
72 x 10904Kb downloads

Free Vista Files award
...targeted offers to them. Use DynamicText to merge database fields and to create messages with individual content...Access, Microsoft Outlook, CSV, dBase, Microsoft SQL Server, MySQL Server, IBM Informix, Oracle, HTML Files and unformatted...
 
mailingnewslettersgeolocationmailinglistemailmysqlmarketingsendbulkemails
Free Vista Files award
...EMS SQL Manager for MySQL Freeware is a high performance tool for MySQL...database administration and development. It works with any MySQL versions from 3.23 to the newest one and...supports all of the latest features including MySQL triggers, views, stored procedures and functions, InnoDB foreign...Unicode data and so on. SQL Manager for MySQL allows you to create/edit all MySQL database objects,...
 
mysql create databasetools for mysqlmysql managementmysql toolsmysql server toolsmysql schemamysql administrationmysql sql querymysql database developmentmysql database toolsmysql client toolsmysql gui
Toad for MySQL

Freeware by Quest Software
82 x 18096Kb downloads

...Toad for MySQL empowers MySQL developers and administrators develop code more efficiently. It...import/export data and administer the database. Toad for MySQL increases developer productivity and offers access to a...
 
developmentadministrationdatabasemysql
dbQwikSite

Shareware by TheDevShop Ltd.
38 x 20062Kb downloads

Free Vista Files award
...way to build data driven web sites. Create database web sites and never write a line of...the way you work. Other tools analyze your database and create pages based on your table design....with MS Access and ASP, then deploy to MySQL and PHP on a Linux server. dbQwikSite offers...
 
web designecommercephpweb builderweb developmentcode generatorweb authoringsite builderweb storeweb databaseaspnetonline databaseqwiksite
General SQL Parser .NET version

Shareware by SQLParser.com
24 x 2700Kb downloads

...code with lots of customizable format options,identify various database objects such as table, column, constraints in sql...to deal with SQL statement used by different Database Such as Oracle,DB2,Informix,Sybase,Pos tgres,MySQL and so on. And...DELPHI, Free Pascal, Kylix Create parser for different databases such as MSSQL,Oracle to deal with different sql...sql, then rebuild on the fly.
 
parsersql
Ad Logger

Freeware by MHC
20 x 40Kb downloads

...Ad Logger stores the IP numbers, in your MySQL database, when someone clicks on your banners. Ad...
 
calculatemarkete-businessmoneysupplyprofitdemand
Free Vista Files award
...Constructioner Light Edition enables you to build up database-connected websites with Content Management System (`CMS`) and dynamic menus without any programming skills. For developers who create their HTML-Layout...
 
pulldownwysiwygcontent managementphpmysqltoolindividual web designcreatemeta-tags
...The ATAF-Support program is a FREE online web database application that can handle online support request. The...
 
databasesource codeuser supportatafiis40chilliiis50asp
...ATAF can automatic convert the database design and copy the data from a MS-Access...database and create it on a mySQL server in one of the 4 following ways...are connected to the same network as your mySQL server, you can convert the database design directly...to the mySQL server, and then copy the all the database...supports ATAF-CON, you can directly convert your MS-Access database from the ATAF-CON application to your ISP`s...
 
ccrdkconversiondevelopmentconstructionprogressas400tableeasyodbcformulasourcelotus notesfieldcodedevelopingkeyms-accessdb2htmlaccesstoaspformconvertmysqlatafbiz
Database Manager

Freeware by Inner-Smile.com
35 x 816Kb downloads

...This tool will support you in your database management activities for dBase-compatible tables, especially if you...are a user of Vista Software`s Apollo Database engine or the Advantage TDataSet descendant or MySQL...(hidden) records), supports deletion, adding, editing and converting database records, displays table statistics, displays and prints table...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
Profi

Freeware by Information Systems
33 x 757Kb downloads

...Project PROFI v 2.1 was developed for use in personnel agencies or personnel department of small and middle sized enterprises. Basic configuration of the project includes: information about customers...
 
convert excelvacanciesresume on-lineadditional modules requestprogram for personal agenciesstatisticsopen soursefreepersonnel agency databasevacant seats
Toko Content Editor

Freeware by Toko Web Service
44 x 104Kb downloads

...for as many users/sites in your domain. No database is required. Simply use your web browser to...
 
contenttokoeditorweb
dbForge Fusion for MySQL, Delphi Add-in

Commercial by Devart
11 x 9674Kb downloads

...dbForge Fusion for MySQL (formerly known as MyDeveloper Tools) is a powerful...add-in designed to simplify the MySQL database application development process. It integrates into Delphi, making...all database development and administration tasks available from your favorite...- Multiformat data export - Full support of MySQL versions 3.23-6.0 - Direct access to a server...
 
ide extensiondebuggerproject suppoborland delphi 2007database tooladd-inmysqldevelopmentstored programquery builderexportimportcodegearmanagementsql editorcode completion
dbForge Fusion for MySQL

Shareware by Devart
14 x 49931Kb downloads

...dbForge Fusion for MySQL is a powerful plugin designed to simplify MySQL...The tool provides an easy way to manage MySQL connections. When integrated with Visual Studio, the plugin...2012 / 2013 / 2015. dbForge Fusion for MySQL works with any MariaDB database servers, and supports...2012, 2013, 2015 - Integration with dotConnect for MySQL - MySQL Connectivity: * Support of all MySQL...
 
database toolproject supportmariadbdevelopmentmysqldebuggerstored programcode completionquery builderide extensionmanagementadd-inexportimportsql editorvisual studio
...framework. Other classes are: - Distributed computing - Database abstraction layer (Oracle, MySQL, PostgreSQL, and SQLite) -...
 
klorofilcomponentcollectiontelevokeklorofil platformopen sourcephp guiclassesgambartdistributed computingphp encoderframeworkfreesemoknetworkingxmlsmsdatabase abstractionsaltaneralibraries

Freeware by Quest Software
26 x 25468Kb downloads

...Spotlight on MySQL displays a complete visual representation of the MySQL...
 
mysqldiagnosticsperformancedatabase
Visual WebGui Enterprise Manager

Freeware by Gizmox
24 x 673Kb downloads

...WebGui Enterprise Manager is a new open source database administration tool that was developed with Visual WebGui...a provider mechanism which will enable managing multi database types in a unified UI. The application is...with a fully AJAX enabled UI and multiple database type capabilities....
 
oracleaspnetmssqldatabaseviewswebdbatablesmysqladminajaxqueries