1 2 3 4 5 6 7 8 9 ... 21 22 23 24 25 26 27 28 29 30

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...What is the need for encrypting email messages you might ask yourself? But if any...a powerful, highly configurable, yet easy to use email client. It is also a public key email...automatically encrypts all your messages and an anti-spam email client that automatically classifies incoming emails as spam...this software you won`t need to use any more secret passwords. You wont have to do any...
 
spamsecuritysafeemailclientexpressprotectpublic keyencrypte-mail
...and log network activity of the any applications(browsers, email clients etc.). So what does that mean in...
 
proxylogtunnel
Free Vista Files award
...pictures, can be encrypted. You can also send secure email attachments. It runs on all versions of...
 
drive encryptionfile encryptionusb encryptionfolder encryptionpassword protectfolder lockwindows encryptionencryption softwarehide filesdata securitydata encryptiondisk encryptiondata protectionencryption program
Trustix Enterprise Firewall

Freeware by Trustix
85 x 438774Kb downloads

...protects assets and business transactions by ensuring fast, secure connections with the Internet and networks. It enables...
 
free firewall downloadnetwork security softwareenterprise firewall
Free Vista Files award
...the iOpus Private Internet Gateway (iPIG) creates a secure VPN "tunnel" that protects your inbound and outbound...you`re using, but all the way to iOpus` secure connection servers deep in the Internet. This ensures...kind. You just start your favorite web browser, email client or chat software and switch the iPig...
 
public hotspotopensslwpaproxyaeswlannetworkssh80211 abgwepsecuritywifivpnwirelesswi-fiencryption
...the iOpus Private Internet Gateway (iPIG) creates a secure "tunnel" that protects your inbound and outbound communications...you`re using, but all the way to iOpus` secure connection servers deep in the Internet. This ensures...kind. You just start your favorite web browser, email client or chat software and switch the iPig...
 
secure accessserverwpapublic hotspotaesproxysshnetworkwi-fiwlan80211 abgencryptionsslwepsecurityopenwifivpnwireless

Freeware by Eric Pörsel
26 x 693Kb downloads

...AFS securely and reliably protects any type of data against...hard-drives, CD/DVD, USB Sticks. But also suitable for secure data transfer via eMail. No Ads, no Spyware,...
 
toolsdecryptionsecurityfolderafssoftwareencryptionaccesspasswordencodefreewarefileprogramaesdata
Accurate Spam For Outlook Express

Freeware by Accurate Solutions
25 x 1022Kb downloads

...update. Support to Unlimited messages. Support to set secure class. Support to report spam for community....
 
spamfilteroutlook express
Anywhere Media Player

Freeware by Anywhere Enterprises
116 x 4167Kb downloads

...risk-free for life. all you need is an email address to get started. no credit card is...
 
privatesharingsecurepersonalmusicmp3wordkazaawindowsnapsterexcelfile
Anywhere Explorer

Freeware by Anywhere Enterprises
17 x 4167Kb downloads

...the anywhere explorer allows you to save, retrieve, email and share your anywhere account files and folders...14 for life. all you need is an email address to get started. no credit card is...
 
excelkazaamp3filemusicprivatewordsharingwindowssecurenapsterpersonal
Spamdel

Freeware by AGM
24 x 2037Kb downloads

...features, ease of use, and inter-operability with any email program eg Outlook Express, Outlook, TheBat! and so...on. Unlike most other email utilities, Spamdel does all its work on the...
 
utilitydeleteanti-spamsecurepop3outlook expresssmtpfreewareanti spamsecurity
...password protected pages and web pages which use secure HTTPS connection. The new version also captures logins...
 
web page loggerinternet loggerinternet monitoringweb page recorderemail recorderinternet loggingemail spyspy mailstealthspy softwareinternet spymail loggerweb mailemail logger
MailEnable Standard

Freeware by MailEnable Pty. Ltd.
67 x 34838Kb downloads

...providing SMTP (Simple Mail Transfer Protocol) for transmitting email messages between servers on the Internet. Some of...you can run scripts or executables on an email SMTP authentication, allow/deny email where the sender domain...Its features are: Supports RFC 1939, supports APOP secure authentication, grant or deny access for IP address...postoffice or globally, configure catchall, abuse and admin emails easily, configure redirection for email...
 
popmailenablemail enablemail serverhttpmailpop3email servere-mailsmtpweb mail
Crypto Anywhere - OpenPGP Edition

Freeware by Bytefusion Ltd.
76 x 2987Kb downloads

...Free Secure Email. Standalone or integrated with Outlook Express or...
 
pgpopenpgpgpg
FineCrypt

Freeware by Crypto Systems, Inc.
76 x 5931Kb downloads

Free Vista Files award
...following features: automated encryption; command line encryption; highly secure encryption with a single mouse click; secure communication...password and with key; session keys and passwords; secure delete feature; statistical analysis of ciphertext; 10 encryption...
 
encryption freewarefinecrypt
netChimes

Freeware by Birnam Labs
18 x 1857Kb downloads

...receive alerts when their software is being downloaded. Email marketers can plant images in their email campaigns...
 
statisticsnetchimescountmessengeralertvisitorwebmasterweblog
SecExFile Home

Freeware by Bytefusion Ltd.
13 x 1747Kb downloads

...data easy. SecEx File can be configured to email the armoured file once encryption is completed. +...
 
armoured filefile encryptionsecure file
Tray Helper

Freeware by Ireneusz Zielinski
17 x 36Kb downloads

...spam messages on that accounts * forward important emails to your mobile device * build in auto-responder...3d, speaking, cool characters * Tray Helper is secure - you can set a password and no...
 
anti-spam email checkerpopup killertray helperreminder
...Chilkat Certificate makes it easy to get information about the security certificates that are stored on your computer. It also allows you to easily add certificates to a certificate store,...
 
blowfishaestwofishpublic-keyencryptiondelphirijndaelactivexbuilderdecryptioncertificatevisual basicpkidigital signatureasp