1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...desktop, you need a reliable, real-time method to monitor your Windows system before these pesky bugs start...
 
windows processfreewarewormviruspopup blockwindows applicationtrojansecurityspywareadware
StatWin Professional

Shareware by SXR Software
25 x 7818Kb downloads

Free Vista Files award
...StatWin Professional lets the user monitor and analyze statistics on computer performance and user...and other details. StatWin Professional also lets you monitor user activities and administer the system, even in...the stealth mode, so users of the monitored computer cannot suspect the presence of the monitoring...The program can log keystrokes, capture mouse clicks, monitor clipboard and take screenshots of the desktop over...
 
printerscreenshotskeykeyloggerinternetstatwinsxrsoftprocessadminmodemnetworkmonitorprotectuser monitoringremotecomputer monitoring softwareemployeefile
SentryPC

Demo by SentryPC
44 x 347Kb downloads

Free Vista Files award
...time management software solution. Entirely cloud-based, you can monitor and control any number of computers, and their...you are. View `up to the second` real-time activities of everything your users do including keystrokes typed,...for their parental control, employee monitoring, and overall monitoring and control solution!...
 
softwarecomputerinternetcontrolrecorderrestrictmonitorfilteringmonitoringmanagementsupervisionemployeekeyloggerparentalaccessrestriction
Free Vista Files award
...Actual Spy is a computer activity monitor and keylogger, that allows you to keep track...capture, program log, clipboard monitor, printer monitor, websites monitor and records all changes in file system. It...control all user actions and allows you to monitor system events. It runs hidden in the background,...their children. Helps any computer user see what activities took place in their computer....
 
logspressingkeyloggerkeyboardsecuritysendsstealthreportscomputerclipboardmonitorshiddeninvisiblecapturee-mailprogramsspyrecordkeystrokesactivitymonitoringscreenshots
Desktop Surveillance Personal Edition

Shareware by Omniquad Ltd
15 x 2675Kb downloads

...Internet misuse. Protect children or young teenagers. Omniquad Desktop Surveillance is a powerful Monitoring and Access Control...laptops. This product allows you to supervise and monitor web surfing, e-mail, chat rooms, game-play and other...computer by children or some one else, use Desktop Surveillance! The unique ability to create ‘video-like’ surveillance...but without need for hardware.
 
preventaccess controlinternet misusemonitor
Inlook Express

Shareware by Cinarsoft.com
19 x 1655Kb downloads

...your computer when you are not there to monitor them. Read their emails, chat scripts, letters they...net. Especially useful for parents who want to monitor their childrens activities. * Our prices are a...
 
protectkeystrokesscreenshotsnapshotparentaldesktop spylogsscreendumpchildrenfamilyfilterloggermonitorinlookcontrolexpress
True Launch Bar

Shareware by Tordex
17 x 14507Kb downloads

...From the taskbar you will be able to monitor resources and network activities, access the address book...
 
taskbartoolbartruelaunchlauncherrundesktop

Shareware by EAM Corporation
14 x 4619Kb downloads

...PC Monitoring Software is an application for real time network..., and for employees` work time tracking. Instant Monitor allows you to monitor employee`s activities on all...file, download file and upload file remotely. Instant Monitor also can restrict remote computer`s browsing in Internet...program, open website) to remote computer. Additionally Instant Monitor provide a powerful remote task manager, allows you...computer and end any of them.
 
home monitoring softwareremote monitoring softwarefamily monitoring software
Classroom Spy Professional

Shareware by EduIQ.com
61 x 13546Kb downloads

Free Vista Files award
...A simple and powerful classroom monitoring and management application that allows you to monitor...easy. What is it useful for? For classroom monitoring and recording your students activities on remote computers;...For monitoring students in the classroom to achieve better discipline...or assignments; Helping your students by showing your desktop to them; Turning off, restarting, .... remote computers...
 
internetremotesoftwarenetmonclassroommonitoractivityclassroom managementeducationnetworkclassroom monitoringemployee
...you will be able to perform network user monitoring and control tasks. These tasks allow you to...management software will allow you to record student activities such as website URL`s visited, applications ran, keystrokes...View self-refreshing thumbnails of each screen. View any desktop LIVE in full screen mode. It`s never been...easier to monitor a classroom or workforce all at once. As...
 
networkingvpnlanadministrationworkstationremoteemployeenetwork adminstudentcontrolclassroommonitoring
Ashampoo AntiSpyWare 2

Shareware by ashampoo GmbH & Co. KG
518 x 45158Kb downloads

Free Vista Files award
...disables unwanted auto-starting programs. - System Process Monitor: Monitors all system processes and disables them as necessary....
 
trojansecuritytoolspywarewormsrootkitdialerinternet cleanerutilities
...Data Doctor User activity monitoring keylogger software records all keystrokes digits, characters, and...alt, shift etc in hidden log. Recording utility monitor organization staff, family member and children as trace...there activities and prevent them from harmful websites, illegal community...using this software. Keystrokes capture utility works in desktop background independently and store all user activities. Software...
 
savecomputerkey loggerstorescharactertoolhiddensecretactivitytrackviewfindinformationcapturerecordinvisibledataurlfileresultsmonitoringwebsitetracekeyboarddetectsoftware
superkeylogger

Commercial by Shakeel Hasan Khan
42 x 1573Kb downloads

...Superkeylogger allows you to secretly record all user`s activities on a computer, such as web sites visited,...and even take snapshots of the entire Windows desktop at set intervals, just like a invisible surveillance...
 
keystroke recorderkeylogger stealthkeystroke loggersoftware keyloggerkeytrapinvisible keyloggerkeyboard loggerpasswordspassword grabberpassword recorderkeyboard monitorfree key logger
Any Keylogger

Shareware by AnyKeylogger
19 x 3Kb downloads

...Any Keylogger Free, as one of hot monitor software in the world, is widely applied to...parental control, employee monitoring and private detective service. The keylogger not only...including online chat details, clipboard contents and other activities performed on your PC but also block websites...child or employees cannot track keylogger presence as monitoring software remains invisible from Add/Remove program list, Software...
 
any keylogger freefree keylogger
Active Key Logger

Freeware by Winsoul Software
35 x 1730Kb downloads

...it allows you to easily see typical user activities such as chats and instant messages sent or...
 
messenger logchat monitoringactive key loggerinstant messenger monitorbest keyloggerkids monitorrecord all keystrokesfree keyloggerfamily monitoringcomputer monitorspywareactive keylogger homechildren monitor
Computer Monitoring Software

Shareware by Data Recovery Fix
29 x 5160Kb downloads

...Employee computer monitoring software is the most stable and dependable software...to track and monitor internet and computer activities of an employee. Using the RecoveryFix Computer Monitoring...tool (version 11.03 launched), you can secretly monitor employee computer system over a network and view...LIVE Desktop Activities. Software displays desktop screens of other systems on your computer system....
 
spy softwarecomputer monitoring softwareinternet activity recorderscreen recorder softwaremonitor internet activitiesdesktop activity recordercomputer spy softwaremonitor desktop activitiesemployee computer monitoring
Advanced Keylogger Software

Shareware by Keyboard Monitor
58 x 1211Kb downloads

...sound listing music, song, voice chatting conversations. User activities recording tool record every pressed typed keys, special...email , voice chat conversations or microphone sound, monitors application usage, desktop activity, captures screenshots, records music...Keyboard tracer supports all windows operating system. # Monitor multiple user account. # Captures viewed video, screenshots...
 
windowkey loggeremployeesecurityremoteserveradvancedchildcaptureparentalmoveadministrationmp3performancesoundskeyboardchatnetworkrecordingwebmicrophonesongsactivityvoiceimages
Keystroke Capture Software

Shareware by Unerase Files
58 x 2938Kb downloads

Free Vista Files award
...Key stroke surveillance utility is capable to monitor all user accounts and secretly permit you to...text, chat conversations, user ID, passwords and other activities performed on your personal computer. Invisible key logger...children or other user. Password protected Key Stroke monitoring tool is capable to log data from computer...business, vista enterprise and vista ultimate). Keyboard activity monitoring tool has user friendly graphical user interface (GUI)...
 
toolkey logger activitysoftwarecreatekey strokelostkeyboardhiddenwebsitesfilesdocumentsusernameconversationsapplicationtextpasswordsmonitorinvisiblechatsurveillancesecurerecordtypedutilityemail
Computer Activity Monitoring

Shareware by Computer Monitoring
19 x 5160Kb downloads

...Computer Activity Monitoring is powerful software that monitors and records not only the desktop but also...the internet activities of the employee computer. With the help of...this tool, you can secretly monitor any number of computers, take screenshots of desktop...in background and allows viewing of screenshots of desktop and internet activities of the user. Control and...future references.
 
monitor internet activitiesscreen recorder softwareinternet activity recordermonitor desktop activitiescomputer spy softwaredesktop activity recordercomputer activity monitoring
Employee Monitoring Software

Shareware by Data Recovery Fix
16 x 4679Kb downloads

...Employee monitoring software to keep track of your employee activities...or non-domain based network. The powerful software to monitor employee activities works invisibly in background of the...your absence. Stealthy, easy to use employee activity monitoring software which displays every keystroke typed by the...files downloaded, system process, opened/closed windows, and entire desktop activities of the user computer.
 
employee monitoringemployee activity monitoringemployee computer monitoringemployee monitoring softwareemployee internet monitoringmonitor employees work