1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...from a browser, FTP/FTPS client, or WebDAV folder. Active Directory synchronization provides easy integration with existing directory...of e-mail encapsulated in S/MIME is available. This Microsoft Exchange alternative is optimal for a small-to-medium size...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...services monitoring, and custom application monitoring. Applications Manager proactively monitors applications and servers and notifies problems in...and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss Monitoring, Tomcat...availability of the following services : JMX applications, Microsoft Exchange Server, Service Monitoring (any TCP/IP port),SNMP Agent,Web...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
DeviceLock Plug and Play Auditor

Freeware by SmartLine Inc
98 x 1248Kb downloads

...a plain list. Results can be exported to Microsoft Excel for thorough analysis and review. DeviceLock PnP...to select computers for auditing directly from the Microsoft Network tree or from any LDAP tree (e.g....MS Active Directory, Novell eDirectory, Open LDAP, etc.). You can...
 
usb auditorplug and playdevicelock
extVIEW Active Directory View/Search

Commercial by Extensions Software
32 x 1157Kb downloads

...a browser-based solution that makes viewing and searching Active Directory users and contacts fast, easy, and accurate....extVIEW enables you to utilize your existing Active Directory infrastructure to create an easy-to-use, web-based directory of...and readily: * Provide direct viewing access to Active Directory entries! * Maintain a corporate directory of...
 
directoryiisadsiuserldapsearchinternetintranetviewmicrosoftextranetemployeeactive directory
ORF Enterprise Edition

Commercial by Vamsoft Ltd.
23 x 3573Kb downloads

...e.g. regular expression-supported keyword filtering, attachment filtering or Active Directory-based recipient validation. Using the self-learning Automatic Sender...with Windows 2000/2003 built-in IIS SMTP Service and Microsoft Exchange 2000/2003 Servers (which use this service for...
 
dnsblanti-spamopen relayexchangespam filteremail filterrbl

Freeware by NRG Global
16 x 8073Kb downloads

...(SMTP, IMAP, POP3) - LDAP Server Test (Microsoft Active Directory, Open LDAP, Novell eDirectory, Sun Java System...
 
network monitoringserver uptimesystem monitoringwebserver monitoringfile monitoringdatabase monitoringcitrix monitoring softwareavailibility monitoringavailability monitoring
Server Maintenance Portal

Shareware by Absolute Dynamics
19 x 764Kb downloads

...assets across the network. SMP also works with Microsoft Baseline Security Analyzer to determine the security state...reporting. Easy-to-navigate web pages. Flexible reporting options. Intuitive Active Directory searches. Import/Export options. Easy to automate using...
 
asset management softwareserver maintenanceserver doucmentationwindows update serviceswindows patch managementsecurity auditwindows updates
Free Vista Files award
...and Novell. Integrates with software vendors such as Microsoft Exchange, Microsoft SQL Server, Microsoft ISA Server, Veritas...(SNMPv1 and SNMPv2c) and NetBIOS . Support for Active Directory, ADSI, CPU Usage, directories, disk health, DNS,...disk drives, disk spaces, event logs, Memory Usage, Microsoft Exchange, file existence, file size, FTP, HTTP(s), ICMP/Ping,...
 
network managementinternet solutionsnetwork monitordiagnostic softwareinternet softwarenetwork server monitornetwork server software
Proactive Password Auditor

Shareware by ElcomSoft Co. Ltd.
22 x 2540Kb downloads

...examine network security and recover account passwords with Proactive Password Auditor. Find out exactly how secure your...on account passwords. By recovering exposing insecure passwords, Proactive Password Auditor determines the security of your network....passwords are easy to remember, but essentially insecure. Proactive Password Auditor determines the security of your network...passwords to user accounts is another purpose of Proactive Password Auditor.
 
serverpasswordsvistamicrosoft2003windowspolicyipssecurityelcomsoft2000domain controllerauditingppaanalyzingactive directoryanalysingproactive password auditorintrusion preventionreport
...local system credentials. In addition to Domain or Active Directory security, each Windows desktop and server system...that system, and potentially exposes vital corporate resources. Microsoft does not provide a convenient way to disable...
 
migrationlanicumanagementmicrosofthelp deskwindowshipaapassword resetpasswords2000forgot passwordsingle signsecurity2003hashcommon credentialssoxpwdump

Commercial by Executive Software
21 x 43481Kb downloads

...and manage hundreds or thousands of systems as Active Directory objects and/or as Logical Groups and/or by...compliance. Patch Management for a broad range of Microsoft O/S’s. System Scans are automatically saved to help...
 
performancewindowspatch keeperexecutive softwaresitekeepermanagement toolspatchkeepersite keeper
DameWare NT Utilities

Shareware by DameWare
55 x 24230Kb downloads

...Console (MMC). DNTU provides an integrated collection of Microsoft Windows NT administration utilities, incorporated within a "easy...shell context menus. DNTU also contains a powerful Active Directory Object Browser, and extensive Active Directory functionality...
 
active directoryradmindamewareutilities
...TrafficQuota is a quota enforcement extension for Microsoft ISA Server. It enables you to restrict or...connections immediately when traffic exceeds a quota. - Active Directory is supported....
 
internetcontrolextensiontrafficquotaisa serverbandwidth
IDAutomation ASP Barcode Server for IIS

Demo by IDAutomation.com, Inc.
30 x 1126Kb downloads

Free Vista Files award
...by copying just three files to the virtual directory where barcodes are required. This component supports both...
 
barcode server componentactive server pagesiisserver-sideiis barcodeaspbarcode componentasp barcode
uCertify 70-297 Windows 2003 Design Acti

Shareware by uCertify.com
26 x 8436Kb downloads

...PrepKit MCSE 70-297, Windows 2003 Design Active Directory is an interactive software application that helps you...simulates the actual exam. This PrepKit contains 4 interactive practice tests with over 117 challenging questions guaranteed...comprehensively cover all the objectives for the 70-297: Microsoft MCSE Windows 2003 Design Active Directory exam. With...
 
70-297 practice test70-297 notesmcse 70-29770-297 test70-297 study guide70-297 exam70-297 question70-297 mock test

Shareware by Digital Labs, LLC
21 x 1948Kb downloads

...IMFStats gives you statistics and guidance for your Microsoft Exchange 2003 Server Intelligent Mail Filter (IMF). The...Junk E-mail folder options. Key Features: Automatically scans Active Directory for all Exchange 2003 servers. If each...
 
spamimfmicrosoft exchangeintelligent mail filter
NVN (for Outlook)

Shareware by Somebytes
24 x 2305Kb downloads

...Users of Microsoft® Outlook® will welcome this utility. It displays appointments and tasks on your desktop so you don`t loose track. The desktop image remains fully visible. If you...
 
calendar wallpapermultimediaactive desktopscreensaverdesktop calendarwebmasterlinksdesktoptoolswallpaper calendarfreewarepimsystemoutlookdesktop wallpaperutilitiesdigital dashboardmicrosoft agentsoftware
...Admin Report Kit for Active Directory (ARKAD) is a powerful reporting solution for the...Microsoft Active Directory Enterprise. ARKAD collects and reports configuration information about...various objects and their properties in the Active Directory. The reports are presented in a variety...HIPAA. ARKAD has been architected using the latest Microsoft .NET technology, bringing you the best-in-breed reporting solution...
 
reportssecurity reportsactive directory reportsactive directory managementactive directory reporting
Directory Mate

Demo by MADSolutions
27 x 1525Kb downloads

...a wizard based import/export tool for your Windows Active Directory. Quickly export a list of users, open...the comma delimited file in Microsoft Excel, make the changes you want and quickly...like child`s play. Price listed is for one Microsoft Active Directory domain license. Contact us for additional licenses or...
 
exportinformationactive directoryimportusers
Mobile Admin for Palm

Shareware by Idokorro Mobile, Inc
19 x 2821Kb downloads

...full range of network management functions.Users can manage Microsoft Windows, Active Directory, Exhange, llS, SQL Server, DHCP,...System Requirements for the Mobile Admin Server are Microsoft Windows 2000 Professional, 2000 Server, Windows XP and...MB RAM, 200 MB of free disk space, Microsoft .NET Framework 1.1. Minimum system requirements for the...
 
windows mobile telnetvmwaremobile network administrationwireless applicationmobile network managementremote administration