1 2 3 4 5 6 7 8 9 ... 61 62 63 64 65 66 67 68 69 70

Sort by : ReleasedNameDownloadsAddedRatingRelevance
OnLine TV Live

Freeware by jlgsolera
829 x 1697Kb downloads

Free Vista Files award
...and Newspapers ( +1250) on World Wide Web. Media Guide: +750 Full Movies, 1540 Movies trailers, +2500...biggest worldwide. No additional equipment required. Online TV Player support Windows Media Player and Real Player. You...
 
networklivelive the internetstreaming audiovideo feedson-demandvideo clipstelevisionweb list internetinternet broadcastinglive feedinteractivetravelwindows mediastreaming video
SizeMe

Freeware by Lars Werner
127 x 1333Kb downloads

...item. Then it compares that to the given media size, and gives you a list over how...the directory does not fit on the given media size. There is possible to scan any directory...
 
maximizeisomusicplayerthumbzipmp3imagesizeoutputdvd
Audio Track Editor

Shareware by Software How to
57 x 4730Kb downloads

...from microphone, DVD, VCD, CD player, RealPlayer, windows media player, web page, internet conversation, news and radio...
 
choruseditorextractcompressormusicmixaudiosselectinverttoolvideosproductionsilencenormalizemicrophonestretchconvertcutfadephasertrimamplifyrecordinsertnoisefiltertrackfilesdelayreverb
...INFO tags ensures backward compatibility with standard Windows players like MS Media Player. abcAVI Tag Editor shows...
 
copyrightfourcc changercatalogtitlesearchdecoderauthoringmeta tagsvideo and audiocodecencodertags editordivx
Media Catalog Studio Lite

Freeware by ManiacTools
183 x 2926Kb downloads

Free Vista Files award
...impossible to find anything? Fight this problem with Media Catalog Studio, a handy software application for classifying...and tracking media files. This database is capable of identifying media...properties (name, size, etc), tag information or lyrics. Media Catalog Studio features internal tag reader and editor...you can create playlists for WinAmp or Windows Media Player with a few mouse clicks. In addition to...
 
wma tag editorcollection managervideo managerid3 tag editoroggmovies organizeraudiomp3 taggervideo organizermusic organizerwmvcddbmpegmedia organizerpalylist managermp3 organizermp3 managerape
All-in-One Media Player

Freeware by NPS Software
283 x 1398Kb downloads

...favorite MP3 and movie files with this all-in-one media player. All-in-One Media Player supports all popular audio...MPEG, and various DVD standards. Thanks to All-in-One Media Player you will never again loose track of your...
 
musicplayliststylesorganizempegplayervideomoviesmp3play listxviddvdmpgaudiodivx
SecureCentral PatchQuest Free Edition

Freeware by AdventNet Inc.
86 x 30666Kb downloads

...Professional and Server,NT 4.0 Workstation and Server,IE,IIS,SQL Server,MDAC,Media Player etc. and Red Hat Linux and Debian Linux....
 
linux patch managementmicrosoft security patchesmicrosoft patch managementpatch management softwarewindows patch managementsecurity patch managementhotfix management
Theme Manager

Freeware by Stardock Systems
976 x 2127Kb downloads

Free Vista Files award
...- Visual Styles (WindowBlinds & MSStyles*) - MP3 Players (Winamp, Windows Media Player, Cool Player) - Desktop...
 
desktopwindowblindsthemesstardock
AV Manager Display System (Freeware)

Freeware by Viscom Software
118 x 8488Kb downloads

...AV Manager 3.0 supports VIDEO, IMAGE, SCROLLING TEXT, WEB PAGES and POWERPOINT. Screen splitting, online update schedule and group a number of contents with a sequence of playlist. AV...
 
display systemlanledlcdimagebulletinmulti media playerplasmaprojectorsvideowallinternet
Zortam Mp3 Media Studio

Freeware by Zortam
252 x 15512Kb downloads

Free Vista Files award
...Zortam Mp3 Media Studio is all-in-one Mp3 application suite. It has...Ripper, Mp3 to Wav converter. With Zortam Mp3 Media Studio you can batch auto tag your Mp3...
 
mp3 auto taggermp3 organizerid3 taggertag editorlyriccoversmp3 media studiomp3 playermp3 managerid3 tag editorzortammp3 id3 tag editorrippermp3 normalizermp3 tag editor
FilePipe P2P

Freeware by File Pipe
155 x 5701Kb downloads

...as Ares, Fasttrack, Gnutella and OpenFT. The integrated media player allows you to watch video and audio files...
 
gnutellaareseer2peerfilepipefreewarefastrackp2pfile sharingpkazaa
Privacy Keeper

Freeware by PIMASOFT
164 x 67800Kb downloads

...sensitive files from Windows, Microsoft Office, Netscape, Windows Media Player and Internet Explorer. Privacy Keeper is easy to...
 
remove trackskeeperprivacy guarderaserinternet activitypersonal informationerror fixer
EvilLyrics

Freeware by Evil Laboratories
164 x 828Kb downloads

...displays lyrics to current song in Winamp, Windows Media Player, Foobar, iTunes, Real Player, MusicMatch or QCD,...JetAudio, XMPlay, Meedio, Yahoo! Music Engine, AlbumPlayer and more...
 
pluginjetaudiofoobarmeedioaimp2ituneswmpwinampxmplaylyricsspotifywmp classicqcdmusicmatch
DivX Play Bundle (incl. DivX Player)

Freeware by DivX, Inc.
163 x 15195Kb downloads

...This bundle includes the DivX Player and DivX 6.2 codec. Both are free and...adware is included in the package. The DivX Player plays all .AVI and .divx files that contain...codec extends DivX playback support to all popular media players. This package supports English, French, German and...Japanese languages. DivX Player is optimized to play every DivX file with...audio tracks.
 
wm9divx convertermpegdivx dvdencodingh264h263divx windowsdivx codecdvd divxburn divxdivx encodeconverting divxbundlewmvplayernew divxdivx toolswindows mediaxvid
Rosoft Media Player

Demo by Rosoft Engineering
29 x 3517Kb downloads

...Rosoft Engineering proudly presents Rosoft Media Player, a true media player that plays any...right ACM codec installed on your computer. Rosoft Media Player uses the MCI interface to decode files, and...
 
rosoftcdextractorgrabbersrosoft extractordecomposerfreedbcddaplay listermp3ripperspitchaudiograbbercddbstretchthe rippertime stretchrecordingsmusicianstheripperwaveequalizerplayer
Image Eye

Freeware by FMJ-Software
74 x 727Kb downloads

Free Vista Files award
...to be a half-baked editor, format converter, or media player. - It does include a simple slide...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Anywhere Media Player

Freeware by Anywhere Enterprises
127 x 4167Kb downloads

...anywhere media player is the easiest way access and play videos...and music over the internet anywhere media player for windows is an easy to use desktop...windows application. working in concert with microsoft`s media player, the anywhere media player gives you access...anywhere account`s stored videos and music. use anywhere media player risk-free for life. all you need is an...required. no spyware, no adware, no gimics.
 
privatesharingsecurepersonalmusicmp3wordkazaawindowsnapsterexcelfile
...Video Conferencing, Language Translation, File Transferring, Whiteboards, a Media Player, Free Web Hosting, Internet Access, and more,...
 
gamesmedia playervideoencryptionfreeglobal communications networkgcnwhiteboardbrowsere-mailmessage boardsjabberchatvoice
Free CD to MP3 Converter

Freeware by Eusing Software
71 x 1861Kb downloads

Free Vista Files award
...also can clear the play list of RealOne Player and Windows Media Player and support ID3 tag...
 
mp3 convertersmp3 wav converterrippermp3 makefree mp3 converterogg codecogg converterconvert mp3ripper freewarerippersfree ripper
Balthers Graphic Groove Box

Freeware by Balther
52 x 20368Kb downloads

...Balthers Graphic Groove Box is a VJ and Moving Visuals program for the professional digital artist, handling graphics, Flash, videos and 3D. PC key and MIDI control with interactive real...
 
animationreal timemidivideodigital art toolmoving visualsinteractivesoftwareeffect