1 2 3 4 5 6 7 8 9 ... 31 32 33 34 35 36 37 38 39 40

Sort by : ReleasedNameDownloadsAddedRatingRelevance
DivX Play Bundle (incl. DivX Player)

Freeware by DivX, Inc.
163 x 15195Kb downloads

...The DivX Player plays all .AVI and .divx files that contain DivX video and MP3 audio (including...codec extends DivX playback support to all popular media players. This package supports English, French, German and...DivX Player is optimized to play every DivX file with full support for all the advanced features...resume downloads, and progressively play back video, a media manager, and a new burn-to-disc feature for creating...
 
wm9divx convertermpegdivx dvdencodingh264h263divx windowsdivx codecdvd divxburn divxdivx encodeconverting divxbundlewmvplayernew divxdivx toolswindows mediaxvid
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...highly tuned code. - Reads all common image file formats. - Image index feature with very fast...to be a half-baked editor, format converter, or media player. - It does include a simple slide...superior display of high bit-depth images. - Asynchronous file I/O allows decompression to start before file read...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Aplus RM converter

Shareware by Aplus Software Inc.
104 x 7557Kb downloads

...Aplus RM converter - convert any video to any video. Can...to convert almost all kinds of Video format files including AVI, DivX, XviD, MPEG, WMV, MOV, RM...ASF, WMV, WMA, MPEG, MOV, QT, RM, RMVB, file without losing quality. 2).Support convert AVI, Divx, ASF,...WMV, WMA, MPEG, MOV, QT, RM, RMVB, file to AVI with all encode format such as...ASF, WMV, WMA, MPEG, MOV, QT, RM, RMVB, file to MPEG with all encode format such as...
 
wmv mpegavi wmvmpeg movavi movmov mpegvideo cuttermpeg wmvwmv movavi mpegvideo convertermov wmv
DivX Player (with DivX Codec) for 2K/XP

Freeware by DivXNetworks, Inc.
94 x 7500Kb downloads

Free Vista Files award
...and full support for decoding MPEG-4 Advanced Simple Profile video. By enabling playback of all DivX content,...in the DivX video format or reduce the file size of current video files to store them...
 
windows mediadvd divxdivx converterh263h264encodingconverting divxdivx windowsmpegburn divxplayernew divxdivx toolswmvdivx encodedivx dvdxviddivx codecwm9
DivX Player (with DivX Codec) for 98/Me

Freeware by DivXNetworks, Inc.
70 x 7409Kb downloads

Free Vista Files award
...and full support for decoding MPEG-4 Advanced Simple Profile video. By enabling playback of all DivX content,...in the DivX video format or reduce the file size of current video files to store them...
 
burn divxplayerencodingconverting divxdivx codecdivx encodedvd divxdivx dvdwmvh263divx converterdivx toolsxvidmpegwm9h264divx windowswindows medianew divx
MediaMonkey

Freeware by Ventis Media, Inc.
108 x 14847Kb downloads

Free Vista Files award
...data via Freedb and the web, offers a file renamer to rename and organize them, and a...
 
movie managerwmaoggripperdlnaupnpmanage playlistmp3 convertermedia managermedia playermanage mp3music managersyncmp3 encoderm4arecorder
Acala DVD Ripper PSP Bundle

Shareware by Acala Software Inc.
40 x 3429Kb downloads

...The build-up enhanced encoder deep compress output min files with high speed and lossless movie quality. With...freely.With Acala DVD Ripper, don`t worry about your media knowledge base, for it does all for you....professional. Build-up enhanced encoder ensure the output AVI file less than 200MB lossless movie quality. One click...Batch convert main movie and any episodes. Batch files conversion. Preview playback movies and any episodes.. Automatically...
 
dvd avidvd copy avixvid pspdvd backup mpegavi pspmpeg pspdvd copy mpegdvd backup svcddvd movie avidivx pspmovies pspdvd movie vcdmovie pspdvd backup vcddvd ripperdvd vcdmpg pspdvd movie svcddvd movie mpegdvd backup avipsp moviesdvd mp
STOIK Video Converter

Freeware by STOIK Imaging
95 x 29309Kb downloads

...optimum quality on your video player! STOIK Video Converter Pro takes video files in any size and...perfectly. With more than 275 presets, STOIK Video Converter Pro knows exactly the specs of your video...sharing service. With 275 one-click presets, STOIK Video Converter Pro takes care of video hell, selecting the...correct resolution, bitrate, format and file size specific to your player. Convert between AVI,...
 
conversionfiltersetsmp3eposidemovfpsfreeware video converterframeratewindows mediawmvclipsmpeg mpegmkvdivxcodecsscenespliteditorstoik
ClipCollect

Freeware by Visoracle
19 x 1039Kb downloads

Free Vista Files award
...approach for building a website by converting any file directory contents automatically to HTML with only 3...snippets and save them along with any other files into a directory structure. Then start ClipCollect`s automatic...hard drive to HTML. All subdirectories, text and media files get assembled into HTML pages whose linkage...
 
buildebookfreewareimage gallerynoteeditorpimconverterwebsitehomepageplain textdatabasegeneratorcataloguehtmlcreateformatterbuilderformattingclipboardcreatorhelp manual
...Free WMA to MP3 Converter can convert Windows Media files to MP3 files which can be played...in MP3 Players. All Windows Media formats (*.wma, *.wmv, *.asf) are supported. The program...5.ID3 Tag can be derived from the input files automatically. 6.Batch Processing is supported, it can process...an unlimited number of files at one time. 7.Detailed HTML help file is...
 
wmaasfwmvmp3freewareconverter
...also see how the capacities of popular storage media compare - eg. the wide range of floppy...you`re done, pressing `Make File` results in a textfile in CSV format of your chosen conversions being...
 
base converterdata rate converternetwork address converterbit invertdecimalbit shifthexdata storage units converterbit rotatedata speed units convertercolor value displaybinary converter
AACoder Plus Free

Freeware by Pianosoft
28 x 5934Kb downloads

...(AAC), WMA, Ogg Vorbis. Product supports AAC Mp4 file type - probable inheritor of Mp3 due to...has much more efficient compression resulting in smaller file size and very fast encoding. AAC Mp4 audio...is very easy to use. Just add the files you want to convert to the list, conveniently...adding whole folders and sub folders containing audio files to conversion list. High converting speed and batch...
 
ogg vorbiswmawaveaacmp3windows media audiomp4batch conversionitunesipodconverteraudio formatencoder
Free Vista Files award
...River Past Audio Converter is an easy-to-use, fast, and powerful batch audio...(The True Audio encoder), WAV and WMA (Windows Media Audio). It can also extract audio from mobile...MP4 (MPEG-4 video), MPG (MPEG-1 and MPEG-2 Video), RealMedia RM, OGM (OGG Media), DVD VOB, WMV (Windows...can also choose from a list of Windows Media profiles. Audio Converter Pro adds the ability to...
 
wavaiffaifcac-3mp4divxivfvcdwmvquicktime movmkvflacram3gpp2apedvd vobmpeg-1mpgxvidmkaogmwmaogg vorbismpcasfmpeg-2sd2ofrm4amp3mpasnddattta
AudioAlchemy OGG Edition

Shareware by Mystik Media
12 x 4946Kb downloads

...AudioAlchemy OGG Edition can also convert existing OGG files to a different bitrate/quality setting; for example, converting...space is an issue, such as for portable media players, select a lower bitrate to conserve space....the best compatibility with both hardware and software media players, and Variable Bitrate (VBR) is also provided...for further optimized file sizes. All conversions are performed directly from the...
 
ac3oggalacrawencodem4aconverterdecodeflacwavpackwmamp4adpcmmp3aacconversionaiff
Sprintbit File Manager

Shareware by Sprintbit Corporation
50 x 110324Kb downloads

Free Vista Files award
...Sprintbit File Manager for Windows XP/Vista/7 (all systems 32-64 bit)...a fully featured application for viewing and managing files on your or network computer. You can perform...all standard file operations like copying, moving, renaming, deleting, creating folders,...shortcuts etc. You can process multiple files to a several folders at once by use...macro commands or Multi File Manager. You can open unlimited number of File...
 
file viewerfile explorerfile managerpicture viewercryptographystartup managerwindows explorer replacementfile browsertext editorwindows file managerdocument managementzip archiveencryptionfile renamer
Apex Movie Converter

Shareware by Apex Software, Inc.
24 x 7232Kb downloads

...Apex Movie Converter is designed to convert your fond movie to...and friendly user interface let you convert video files between many formats with ease. The powerful features...and unbeatable price make Apex Movie Converter an affordable and powerful video conversion solution on...ASF, WMV, WMA, MPEG, MOV, QT, RM, RMVB, file to AVI with all encode format such as...ASF, WMV, WMA, MPEG, MOV, QT, RM, RMVB, file to MPEG with all encode format such as...
 
media convertervideo converterconverter total videoconverter videodivxvideo editmpeg converterxvid convertermov convertervideo splitmovie converterconverter file videoavi converterdivx converter
Audio/Video To Wav Converter

Shareware by DigitByte Studio
54 x 562Kb downloads

Free Vista Files award
...Audio/Video To Wav Converter is an easy-to-use tool for converting almost all...kinds of audio and video files to a wav file. With the build-in multimedia...player, you can preview the media file, set start time and end time, convert...any audio section of the file without quality loss. The key features include: Convert...to WAV, SND to WAV, etc. Split WAV file into smaller piece. Preview audio and video. Fast...
 
avi wavac3 wavdat wavmpeg2 wavmpeg wavogg wavmp2 wavdivx wavm4a wavwmv wavogm wavasf wavaif wavmpa wavvob wavwma wavvcd wavsnd wavxvid wav
Cool All Video/Audio to MP3/WAV Converter

Shareware by Magic Video,Inc
34 x 12556Kb downloads

...Cool All Video/Audio to MP3/WAV Converter - Create MP3s and WAVs from audio found...various video/auido files! Cool All Video/Audio to MP3/WAV Converter is a powerful video/audio batch converter that can...convert any kind of Windows media file to MP3 or WAV. Media formats include AVI,...
 
mp3converteraudio
iVideoMAX

Shareware by Softdiv Software
30 x 9000Kb downloads

...is a powerful and effective solution for video file conversions. This easy-to-use interface allows you to convert...video files between different formats, create new video files from sequence of separate pictures, split or join...video files and also preview the results to make sure...and SVCD, PAL, and NTSC) - WMV (Windows Media Video); - RM (Real Networks Video); - DVD...
 
wmv converteravi mpegasf converteravi asfvideo converteravi wmvmpeg asfavi converteravi vcddvd convertavi dvdmpeg avimpeg convertermpeg wmv
A-one Video Joiner

Shareware by yaomingsoft
33 x 12419Kb downloads

...a professional video tool to join multiple video files into one large file, you can combine multiple...AVI, MPEG, WMV or ASF files into one large video file, and save as...You can add an unlimited number of video files to the list and easily rearrange their queue...ASF, WMV, WMA, MPEG, MOV, QT, RM, RMVB, file without losing quality. 5)Support join / convert AVI,...
 
avi wmvvideo joineravi mpegavi movwmv mpegvideo convertermov wmvmpeg movwmv movmpeg wmvmov mpeg