1 2 3 4 5 6 7 8 9 ... 267 268 269 270 271 272 273 274 275 276

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AFP Printer Driver for Windows

Demo by IPDS Technologies, AG.
3 x 4747Kb downloads

...24bit RGB), and full color (32bit CMYK) Color Management with ICC Profiles Adjust image resolution between 300x300...
 
zseriesworkbenchvieweras400windows7windows10segmentinfoprintafpprinteroverlaypagestreampdfwindows8driveribmdataafpdsiseriesprintingipds
..."ESurvey Sections" is a complete Section Creation and Management Solution designed to help engineers, surveyors and designers...
 
volume calculationcross sectionprofile correctionsuper elevationlongitudinal sectionroad designend arearoad wideningtrapezoidal rulenett areasimpsons one third formula
CapeTools QuantTools XL

Commercial by CapeTools QuantTools
18 x 60402Kb downloads

...2100 functions used for managing, pricing and risk management of financial derivatives. Over 120 categories of financial...
 
credit derivativesbondscredit default swapsspreadsheetforeign exchangetechnical analysisfixed income derivativescommodity derivativesequity options
PG Social Networking software

Shareware by Pilot Group Ltd
16 x 191Kb downloads

Free Vista Files award
...Start your business community site with PG SocialBiz - turnkey business social networking software! 3 social networking designs: Corporate, Business and Niche community styles! Multi-administration system, multilingual interface, advanced SEO...
 
social network softwaresocial networking scriptscreate social networkcommunity softwaresocial networking softwarecommunity scriptsocial network script
Aurigma Graphics Mill for .NET

Shareware by Aurigma Inc.
18 x 24067Kb downloads

Free Vista Files award
...read support), convert between color spaces, use color management profiles, apply various transforms, artistic effects and filters,...
 
wbmpconvertthumbnailicmrotategificcred-eye removalcmykpdftiffeffectsgraphicssharpenblurimage correctionajaxlossless jpeg transformdisplayimagingresizeformatpsd
Single Operator Live Support Chat

Shareware by iPod restore
36 x 1146Kb downloads

...Navigator, Opera and other web browsers. Customer relationship management tool increase your sales and customer or website...
 
multilingualdisplaysoftwaremessagesajaxutilitysingleexecutivesupportpasswordcompanyliveoperatorofflinetoolbasedchatsendasphostprogramcommunicateprotectedvisitorsaddresscustomerwebsite
EaseUS Partition Master Server Edition

Demo by EaseUS
22 x 29858Kb downloads

...8. The first attractive feature is its partition management function to extend server system partition without reboot,...
 
resize dynamic system volumeeaseus partition masterserver partition magiccopy dynamic diskserver partition managerone-click upgrade system diskdisk copyresize partitionrepair raid-5merge partition
XSpy Shield Gold

Shareware by Elcor Software
22 x 3647Kb downloads

...Positive side: real time protection, deep file scan, complete system scan, highly configurable XSpy Shield is a powerful and efficient anti-spyware solution, developed by Elcor Software company. It was...
 
wormstrojansnetwork managementgeneric malwarebrowser hijackerspluginsvirusesremote adminstration toolsspywarekeyloggersadwaredialers
CapeTools QuantTools Developer

Commercial by CapeTools QuantTools
14 x 60402Kb downloads

...2100 functions used for managing, pricing and risk management of financial derivatives. Over 120 categories of financial...
 
credit derivativesforeign exchangespreadsheetequity optionsfixed income derivativesbondscommodity derivativescredit default swapstechnical analysis
Comparator Fast

Shareware by D.S.M./Interdesigner
27 x 6417Kb downloads

...Comparator Fast is an application that simplifies the comparison / verification / synchronization status of two different directories on any media (local drives, network drives, writable CD`s, Compact Flash and electronic...
 
duplicate filefoldermatchfile comparebackup toolscompare filessynchronize filessynchronize folderscompare folderssynchronize computers
...provides attractive graphical user interface. * Reciprocal link management utility store different number of website profiles. *...
 
toolutilitymonitorwebpagewatchdomaincsvfindurlanalystchecksoftwarebrowsersearchrankreciprocaltrackeranalysisanalyzerlinkshtmlanchorreportexchangeevaluatorcheckerwebsite
SharpCam

Commercial by SharpCam Ltd
16 x 75301Kb downloads

...tapping, rigid tapping and custom drilling cycles Tool Management Create tool libraries/tool kits with the Tool Manager,...
 
computer aided designcncprogrammingcadcamcomputer aided manufacturing
EaseUS Partition Master Professional

Demo by EaseUS
20 x 29858Kb downloads

...8. The first attractive feature is its partition management function to extend system partition to solve low...
 
one-click upgrade system diskeaseus partition masterresize raidcopy dynamic diskresize dynamic diskfree partition softwareresize partitiondisk copymerge partitionconvert partitionfree partition managerpartition magic
CyPics - Photo Cataloging

Shareware by CyWarp
20 x 18904Kb downloads

...Photo Cataloging Software with the flexibility and features to manage your growing digital photo collection. Create high quality slideshows in minutes utilizing timelines or for complete control sequence the images...
 
pictureexifslideshowsoftwareiptccataloguingalbummanagementdatabasecypics photo catalogingdvdimagedigitalcameraphotographorganizerphotographyelectronicasset
EditPad Pro

Shareware by Just Great Software
6 x 11778Kb downloads

...EditPad Pro is a powerful and versatile text editor or word processor, designed to make text editing as convenient as possible. Write and edit all your plain text files such...
 
editprowritingcodersyntaxemailwordcoloringeditorsprogrammerspelltextwebwordpadwriternotepadedithexprogramminghex editorhexadecimalprocessorediingtext editorftphtmlcodinghighlighting
Image Compressor 2008 Pro Edition

Shareware by MasRizal & Partners
15 x 9709Kb downloads

Free Vista Files award
...The perfect after-the-shot software, Image Compressor provides comprehensive set of tools. You can easily import, capture, scan, retouch, compare, create photo album, share and compress your images more...
 
stampcompresswatermarksmoothzipalbumsonyeditminoltamultipleslrthumbnailexifpictureolympusimageshrinkkodakresizeenlargereduceconvertcanonretouchcameraleicarotateraweyeskewviewernikonphotofujicomparebatchpentax
Business Barcodes

Shareware by Business barcodes
11 x 3850Kb downloads

...library, shipping, manufacturing, transportation, blood bank and inventory management etc. Business barcode builder software efficiently runs under...
 
businessprogramcustomizedshapecolormakerprofessionaljpgseriesbmpdesignwindowsbarcodefonttagjpegsequentialutilitydimensiongeneratelabelstickerassetslinearapplicationconstantproducesizedensity
CutLogic 2D

Shareware by TMachines, s.r.o.
13 x 9559Kb downloads

...· Full material and remnants (reusable rests) inventory management · Batch control support – tracking capabilities for...
 
cuttercostnestingutilizationsoftwareoptimalguillotineprogramlayoutwoodmaterialminimize2-dcutlogicsavesolvewastecuttingstock2-dimensionalsteelmaximizeoptimizeroptimizationwoodworkingoptimizedoptimizingsavingsmetal
Back Links Checker

Shareware by Data restore
9 x 958Kb downloads

...require any type of additional software. Professional link management program provide complete install and uninstall support and...
 
generatesearchbacklinkreciprocal linkinboundanalyzeengineprogramstatuscheckersoftwaretooljava scriptimprovepositioncsvadvertiserpage rankreportalerttxtfindevaluationinlinkspublisherutility
Free Vista Files award
...activity traces of various application files like Microsoft management console, power point, access, word, excel, paint, media...
 
overwritedatacriticalpersonalrecordsconfidentialfoldersdeletedinternetwipesstoragecleanuphistorycookiesprivatefilespermanentlyremovessoftwarecacheeliminatesdrivecontentsinformationerasure