1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
119 x 126464Kb downloads

Free Vista Files award
...from a browser, FTP/FTPS client, or WebDAV folder. Active Directory synchronization provides easy integration with existing directory...and the need for an easy-to- use and manage collaboration and messaging solution....
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Adventnet ManageEngine ServiceDesk Plus

Freeware by AdventNet Inc
189 x 37002Kb downloads

...based, easy to use Help Desk and Asset Management software whose features include contract managenent, purchasing and...knowledge management functionalities. It has an ITIL ready version too....By integrating Ticketing, Asset Tracking, Purchasing, Contract Management and Knowledge base in one low-cost, easy-to-use package,...& user satisfaction survey. Version 7.0 adds Enhanced Active Directory Integration, enhanced purchasing system with approver,...
helpdesk softwareservice deskcontract managementitil help desktrouble ticketingsla managementinventory managementknowledge basepurchase order managementasset management
2X ThinClientServer for Windows

Freeware by 2X
82 x 6936Kb downloads

...Centrally manage user connections, thin client devices & convert PCs...convert existing PC`s to thin clients and centrally manage thin client devices from any vendor (HP, Neoware,...centrally by device, user, group or department (Active Directory / LDAP) via the web based interface. 2X...ThinClientServer v3 makes Windows manageable - ON LINUX! It deploys a secure, centrally...
thin clientsrdpterminal servicesthin client terminalthin client softwareterminal servercitrixserver based computing
ManageEngine Desktop Central

Commercial by ZOHO Corp.
144 x 104448Kb downloads

...Enterprise Desktop & Mobile Device Management Software providing Role based Administration, Software Deployment, Creating...Deployment, Asset Management, Warranty Tracking, Remote Control, Configurations, Active Directory Reports, User Logon Reports and Windows System...With its network-neutral architecture, the administrator can easily manage any networks like Active Directory, Workgroup & Novell...10.7, 10.8, 10.
warranty trackingremote desktop managementconfigurationspatch managementmobile device managementsoftware deploymentdesktop administrationinventory managementactive directory reportsrole based administrationpower management
2X ThinClientServer PXES

Freeware by 2X
32 x 6985Kb downloads

Free Vista Files award
...Centrally manage user connections, thin client devices & convert PCs...convert existing PC’s to thin clients and centrally manage thin client devices from any vendor (HP, Neoware,...centrally by device, user, group or department (Active Directory / Local Accounts) via the web-based interface. 2X...* Converting existing PCs to thin clients * Manage users` connection settings centrally by user, group or...
server based computingrdppxesdesktop virtualisationthin clientsfree thin clientthin client softwareterminal servicesterminal server
...BAT files. You can also use it to manage the source code when several independent authors make...in files with a large number of changes. Active File Compare has its own File Manager consisting...of files to be displayed in the File Manager by using filters. Supports Zip, Tar and GZip...

Demo by Wennstrom Software
41 x 3449Kb downloads

...the Windows, Linux and Novell network administrator. Batch manage SAM, AD, OpenLDAP, NDS, eDirectory, Exchange, Terminal server,...accounts, including passwords, between different platforms. Create or manage accounts on many platforms at once. Collect system...multiple Windows machines. Search for files and calculate directory sizes across multiple machines. View remote Windows services...and processes.
active directorylinuxopenldapexchangeaccounthashregistryevent logremote controledirectoryinventoryadministratorpasswordnovellsamba
...application to copy complete websites and homepages and manage them in one recherche. Differently than than all...be named by the user. Technical Features: The directory structure of a copied website is kept and...no differences in handling Web2Map while downloads are active or not....
recherche manageroffline browsersitegrabberwebsitefilefilterinternetmaximum linkdepthoffline readersitemapsofflinereaderfulltextsearchlinkcheckerzip formatintegrated browserarchiving

Commercial by Tipic Inc.
76 x 1722Kb downloads

...- Easy to install and manage TIMP is a Total Instant Messaging (IM) Solution...based TIMP runs on Windows 2000 and has Active Directory - LDAP / XMPP / Jabber integration;...
Akeni Enterprise Instant Messaging LDAP

Shareware by Akeni
58 x 8007Kb downloads

...messaging system that offers strong encryption, along with Active Directory / LDAP integration. It also provides corporate...im messaging policy management through the use of shared public groups and...Shared public folders allows the administrator to easily manage user accounts from one central location. By adding/removing...
enterprise instant messengerakenibusiness instant messagingnotificationcorporatesocial networking softwarecollaboration software
...that have been set and stored by User Manager Pro and/or Random Password Manager. The Password Recovery...local system credentials. In addition to Domain or Active Directory security, each Windows desktop and server system...provide a convenient way to disable or easily manage all of the local accounts that exist in...a company’s Windows environment. Too often, network managers are forced to take a shortcut, like setting...
migrationlanicumanagementmicrosofthelp deskwindowshipaapassword resetpasswords2000forgot passwordsingle signsecurity2003hashcommon credentialssoxpwdump

Shareware by Absolute Dynamics
17 x 1367Kb downloads

...Quickly search Active Directory for users and computers and manage them across...that can administer users and computers in your Active Directory. Search by the display name, username or...disable accounts, add or remove users from groups, manage computers over the network and much more......
portalactive directory usershelp desk software2000manage userswindowsdoucmentationwebadminmanage computersactive directory computersservermaintenance

Commercial by Executive Software
21 x 43481Kb downloads

...Sitekeeper 3.5: Systems Management Software Simplified Sitekeeper provides the essential tools necessary...to manage the systems on your networks without the complexity,...or bloat you’ve come to expect from systems management software. Sitekeeper 3.5 provides Hardware and Software Inventory,...Software Licence Management, Software Deployment and Patch Management in a nimble, easy-to-use package that runs right...
performancewindowspatch keeperexecutive softwaresitekeepermanagement toolspatchkeepersite keeper

Shareware by SaM Solutions
33 x 3134Kb downloads

...event log as simply as with TStringList; - Manage the information on users and groups; - Manage...Configure group policies on standalone computers or in Active Directory; - Browse for existing group policy objects;...- Browse for Active Directory containers. Please note: the provided version supports Delphi...
task scheduleregistrygroup policiessharingwindows 2000terminal adminactive directory containerssend messagesservicesserver infodelphiusermanbrowse networksprivilegesevent logfirewall configuresecurity

Demo by Port80 Software
38 x 1127Kb downloads

...the changes and deploy them in your target directory - a natural final step before launching new...In addition to code optization, w3compiler can also manage file names and extensions, making sites smaller and...
FileWay Free

Freeware by Everywhere Networks
22 x 32768Kb downloads

...Continuity Solution Download, upload, email, edit, view and manage documents, directories from any browser. An MS server...is easy. FileWay Free now includes Dynamic live Active Directory Integration. Whether 10 or 100,000 employees FileWay...Manager, connects to Active Directory and does the hard work. When changes are...made to Active Directory FileWay dynamically updates.
vpnremote file accessisa serverexchange 2003outlook web accessssl remote accessexchange serversharepoint
emagiC CMS.Net

Commercial by Emagine
30 x 6347Kb downloads

...development of a cost-efficient and user-friendly Enterprise Content Management System emagiC CMS.Net. The emagiC CMS.Net framework is...framework comes with a number of modules to manage different types of content, such as wysiwyg editor,...gallery, document gallery, mailForm, external feed, search, newsletter, active directory. The XForms application, based on the new...standard, is the flagship of the modules.
free versioncontent managementportalxformssite managementcms
WinQuota Corporate Edition

Commercial by WinQuota LLC
41 x 3073Kb downloads

...WinQuota Corporate Edition is disk quota management software optimized for large and huge companies, with...WinQuota Corporate provides the ability to specify domains, active directory, and even LDAP queries to find users...excess triggers. All the WinQuota settings can be managed as via GUI as using command line tools...contains Web Console as an alternative way to manage quota limits remotely via browser, SNMP traps, SNMP...
shared diskquotasdisk quotawindows2008winquotanetworkingtoolfoldersdirectoryquota managementreal-time quotaquota settingsserverlimitdisk spaceenterprisesoftware2003utility
Mobile Admin for Palm

Shareware by Idokorro Mobile, Inc
19 x 2821Kb downloads

...to securely perform a full range of network management functions.Users can manage Microsoft Windows, Active Directory, Exhange,...
windows mobile telnetvmwaremobile network administrationwireless applicationmobile network managementremote administration
Mobile Admin for BlackBerry

Shareware by Idokorro Mobile, Inc
26 x 2821Kb downloads

...to securely perform a full range of network management functions. These include Microsoft Windows, Active Directory, Exhange,...Domino Console commands, run scripts or SQL queries; manage the BlackBerry Enterprise Server; even lock or kill...
vmwareremote administrationmobile network administrationmobile network managementwindows mobile telnetwireless application