1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Actual Contacts for Outlook

Shareware by MAPILab Ltd.
11 x 7671Kb downloads

Free Vista Files award
...The add-in also supports validation of the recipient list in Mail Merge Mode in Microsoft Outlook and...
 
contactemailmsoutlookupdate contacte-mailaddinpluginverify contactsmailing listcheck contactsadd-inusers groupscheckingoutlook softwarecontacts verifingaddonoutlook contactsdistribution list
Email Validator

Shareware by Byte Foundry
25 x 1189Kb downloads

...receive any message as a result. Once a list of email addresses has been tested, the user...non-deliverable addresses in order to clean an existing list or build a new one containing only deliverable...addresses. The result for anyone who runs a mailing list, i.e. ezine and newsletter publishers, businesses, political...
 
contact listlist managementemaildatabaseverificatione-maildistribution listverifymailing list
Free Vista Files award
...Maintain clean mailing lists checking the validity of recipient`s e-mails addresses. eMail...Verifier verifies every e-mail address from a given mailing list, allowing you to determine 80-90% of "dead"...a very effective piece of software that can verify over 10 e-mails per second . It can...
 
e-mailvalidemailcheckerverifieraddressmailboxvalidity
Advanced Email Verifier

Shareware by G-Lock Software
4 x 13283Kb downloads

...race. It is important to maintain a clean mailing list and remove bounced, undeliverable emails because a...Advanced Email Verifier you can: -Clear your email list or database from bounced and undeliverable email addresses...that allows you update and keep your contact lists "clean" on a proactive basis. This means you...can protect your email server domain from getting blacklisted and increase your email campaigns performance. -Decrease the...
 
email checkercheck bad emailsemail verifierverify invalid emailslist cleaner
...e-business managers know that current customers database and mailing list maintenance task is one of the toughest...it is a wise choice to check the mailing list for so called `dead` addresses every here...this important stage. As a result we get unrealistic expectations which in turn means direct profit loss....not really! Introducing Atomic Mail Verifier, the unique mailing list entries verification software intended for lightning-fast...
 
mailing listemailmail listmaillistvalidatecheckverify
Contacts Verifier

Shareware by MAPILab Ltd.
8 x 4Kb downloads

...addresses from an address source used for mass mailing and excludes invalid addresses. When checking an address,...
 
verify contactsaddinusers groupsaddonpluginmailing listdistribution listmsoutlookcheck the contactscontacts verifingoutlook contactschecking
Smart Email Verifier

Shareware by DeskShare
12 x 4112Kb downloads

Free Vista Files award
...will check every email address from a given mailing list and determine if e-mails are still valid....will check the e-mail syntax, next it will verify the existence of the SMTP mail server and...
 
validate emailsmtp checkverify emailemail syntax
Super Email Verifier

Shareware by flashemailcast.com
17 x 1180Kb downloads

...that verifies the validity of e-mail addresses in mailing lists. The program works on the same algorithm...disturb your clients and friends anymore just to verify their addresses. It connects directly to their SMTP...
 
email validemail verify
...Robot can extract email addresses from the Internet, verify email and removes all invalid email addresses from...your mailing list, direct send bulk email from your PC...
 
email parseremail spideremail marketingemail verifieremail senderemail extractor
High Speed Verifier

Shareware by EMMA Labs
10 x 3858Kb downloads

...addresses per second. It can easily deal with mailing lists containing tens millions of addresses; moreover, it...is with this list size that the program`s highest performance can be...detects about 20-30% of invalid addresses in a mailing list, though theoretically it is possible to detect...
 
verify emaildead emailclean mail listmailing list verifyemails verificationemail verification

Shareware by SEND-SAFE
23 x 1477Kb downloads

...Send-Safe Email List Manager is a brand new email list management...tool for organizing contact information and preparing your lists for mailing. Send-Safe Email List Manager is an...easy to use bulk email address list cleaner. It will clean and correct duplicated and...implemented: - Extract and clean - Merge E-Mail Lists - Remove Addresses - Keep Addresses - Filter...
 
email list managementmailing list manageremail listsemail addressesbulk email software
WorldCast

Freeware by Fairlogic Systems
56 x 3856Kb downloads

...the common invalid addresses that exists on many emailing lists, reporting errors like bad email addresses, time-out...extensive mail merge capabilities . Given a certain emailing list, containing email, name and job, for instance,...WorldCast as an email-address validator verifies an entire emailing list, reporting the bad and good email addresses....lists, it imposes no limits to the recipient list size.
 
bookfreebulkemailoutlookmasspictureexpressemailingdatabasefeedbackrelaycheckerthesauruse-mailingspellimagebulkmailverifyworldcastcustomizevalidateaddresssendsmtpmerge
Advanced Maillist Verify

Shareware by EMMA Labs
19 x 3538Kb downloads

...Advanced Maillist Verify (AMV) is a program that verifies the validity...of e-mail addresses in databases, address books and mailing lists. Now that`s not just a standalone program...(for most major programming languages) for integrating Advanced Maillist Verify into Internet/Intranet servers based on Active Server...supports all popular file formats - from simple mailing lists to Eudora, The Bat! and Windows address...
 
vrfyaddress verificationverifyingverifingdeadeverifymailaddress correctioncheckingvalidatorcomponentdelivery erroremail verifierwabvalidationmailing list managercheckermailverifyamve-verify
...and URLs are extracted simultaneously to build a list of targeted email addresses for your email marketing...spider extracts any style e-mail addresses. Once your mailing list is built you can auto-removes duplicate or...
 
urlbulkspideringemail extractordata miningharvestercollectorspidersextractione-mailmass mailwebsite spiderweb data extractorextractors
Syndikut - Mailing List Manager

Commercial by Syndikut Scripts
11 x 236Kb downloads

...Syndikut Mailing List Manager v2 is a PHP, subscribers/news letter script....With MLM, you can easily start your own mailing list service for any purpose. MLM allows your...is sent to all active subscribers, printing a list on screen for confirmation. Ever wanted to start...your own mailing service? Email marketing is one of the most...themselves via email link & web form) * Verify Email Address (Sends an email verification link to...
 
scriptsmlmphpmass mailsqlsubscribersletterslistmailingflatfilemanagerbuysyndikutemailnewspaypal
...eVerify can be used to verify e-mail addresses in your mailing lists or database...fields. eVerify does not actually send any messages to the...the need to know any SQL. Once the list is loaded, you can choose to check all...the results are color code in the display. eVerify offers rules that let you customize the way...
 
bulk mailmailing listbulkmailermassmailerbulk email marketingnewslettermass mailer
Live Email Verifier Professional

Shareware by Live Software Inc
12 x 1946Kb downloads

...is designed for users who have their own mailing lists and want to keep them up-to-date. The...Validates 50 000 email addresses per hour Contact Lists up to 500 000 email addresses Powerful Contact...every operation Email Verifier Professional have powerful contact lists Operations: Remove duplicates email addresses Extract email addresses...from specified domain Merge lists Remove from first list addresses contained in second List Find...
 
valid email addressvalidate email addressverify emailemail validationverify email addressemail verificationemail verifier
GSA Email Verifier

Shareware by GSA
11 x 10930Kb downloads

...GSA Email Verifier verifies email addresses from mailing lists, Microsoft Outlook contacts, Windows address book and...allows you to clean up your contact and mailing lists by removing bad emails. Additionally you probably...over 100.000 email verifications per hour). Save time, verify email addresses and keep your mailing list free...of inactive addresses.
 
email validateverify emailcheck emailsmail validatoremail listemail verifier
Email Validation Software

Shareware by Sobolsoft
4 x 797Kb downloads

...Verify email addresses. Save valid and invalid results as...
 
websitescheckermultiplebigmarketingvalidityvalidatemassvalidatorlistbulkverificationcheckinginboxe-mailingemailsverifiere-mailsdifferenthttoutlooksendingaddresses
Syndikut - Mailing List Manager 3

Commercial by Syndikut Scripts
4 x 4881Kb downloads

...Syndikut Mailing List Manager v3 is a PHP, subscribers/news letter script....
 
mailingmanagerscriptstextlistemail logszippredictive searchmultiple emailhtmlcaptchasyndikutphpmass mailflat filecsvnosqlemail tracking