1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17

Sort by : ReleasedNameDownloadsAddedRatingRelevance
MAPILab Reports for Exchange Server

Shareware by MAPILab Ltd.
2 x 23549Kb downloads

...product reports are designed to assist you in mailing system parameters monitoring, resources optimization, mailbox and message...and content, settings and replication, distribution group or mailing list membership. 6) Distribution group reports. Reports by membership...
 
outlook web access reportsservers and storesmessage statisticsconnectors and protocolsmessage flow reportsmapilab reportsmailboxes reportsexchange server reportingexchange server auditpublic folders
...It is important to keep your mailing lists clean. Email Verify Robot will help you avoid...e-mail messages and needs to maintain a clean mailing list. Key Features: Up to 5,000 threads set...
 
email verifieremail extractoremail senderemail marketingemail spideremail parser
Tailwag Personal Mailing List

Shareware by Tailwag Software
2 x 4699Kb downloads

...Mailing list and label software. Ideal for personal or small...an unlimited number of separate address lists. Print mailing labels. Print hard copy reports. Import records from...
 
mailing list programmailing list softwarelabel
...Free Mail Commander is a fast and portable e-mail client with user-friendly interface. Program supports SMTP, POP3, IMAP4, can receive and read plain text and graphic html messages...
 
mailclientemail clientemail managementsoftwareemail managermail mergemail softwareemail mergebusiness contactcustomer managementmailing listemail software
EMail List Organizer Deluxe

Shareware by PrimaSoft PC
3 x 7335Kb downloads

...Email List Organizer Deluxe for Windows: easy-to-use database management software...that helps you to organize and manage your mailing lists. Database management features will help you to...small letters to capital letters, create multiple email list databases, move/copy records between databases, export email lists...to text formatted files, display email list statistics. For the power user, Organizer affords the...
 
email list manageremail correctionemail managementemail verificationemail list databaseemail campaign
SendExpress Lite

Freeware by nTrax design
7 x 545Kb downloads

...SendExpress dispute is a mailing list manager, you can create a contact list and...
 
ntrax designmailing list softwaremailing list freewaresend newslettersend mailing listsoftware newsletter
...Providing you with one of the easiest to use email newsletter software solutions available, Volumail provides you with everything that you need to truly boost your email advertising campaign. Without...
 
Email newsletter software email mailing list bulk email
Database E-Mailer

Shareware by BinaryMark
2 x 1075Kb downloads

...from being sent. You can also define a list of exclusions - e-mail addresses the program should...
 
campaignaccessmysqltrackemailduplicatesql serverhtmlsqlitebccodbcstationaryoraclesmtptemplatesdatabasesend e-mail
...to send personalized email to a permission based mailing list directly from C/C++, programmable database or spreadsheet. Companies,...mail with multiple attachments. - Can handle bulk mailing on a distribution list - Can use up...
 
emailersmtphtml emailbulk emailemail marketingsend group mailpersonalized mailnewsletterpop3email toolkitmerge emailemail listemail newsletternotification softwareemail softwareemail e-zine
Jet Email Extractor

Shareware by Jet Email Extactor
3 x 2008Kb downloads

...email promotion, you will be sure, that your mailing lists are accurate, reliable and fresh. Benefits: - The...fastest way to collect targeted emailing lists with thousands of users; - Only valid emails...
 
mass mail programsdirect email marketingpush productsemail extractoremail grabberemail campaignsbulk emailinternet research programsemail retrieveremail collectoremail capturepromotional address lists
...a mass email marketing program and a bulk emailing sender. You can launch your email marketing campaign...features that enable you to easily manage your mailing accounts and recipients lists. It even removes email...unsubscribers from all recipients lists automatically, if desired. With the powerful and flexible...You can do Job Resend, Job Clone, and Mailing Test before send, etc. EMS Bulk Email Sender...
 
emailing softwarebulk email softwarefree emailing softwarebulk emailingmass emaileremail sender softwaresmtp softwarebulk emailerbulk email senderemail marketingbulk emailers
Ultra Extractor

Shareware by MazePath Software
2 x 485Kb downloads

...recipients, with NO DUPLICATES! You get a clean mailing list, saved in a simple text file which...even cut and paste into your favorite program, mailing list manager, word processor, or spreadsheet! Save your time...
 
email extractorextract outlookmailing listgrabbermicrosoft outlookextract email
Email Validation Tool

Shareware by troyeesoft.com
5 x 1454Kb downloads

...Email Validation tool verifies and cleans up your mailing list by checking every e-mail address in the mailing...email verifier to verify and clean up your mailing list. Email Validation tool instantly verifies the validity...of email address or domain from mailing lists, or .CSV file exported from different databases...are still valid. Simply provide an email address list and verifier will return a valid or invalid...
 
verify email addressemail cleaneremail validatoremail validation softwareemail verification toolemail list managementdomain validation programbulk e-mail verifiercheck domain
Email Spider

Shareware by troyeesoft.com
4 x 1081Kb downloads

...keywords for targeted consumer, internet marketing, website promotion, list management and research. You can build business mailing...to extract data from internet using file containing list of urls. You can filter the extracted email...
 
website crawleremail retrieveremail utilitiesemail marketingemail spideremail collectoremail harvesteremail extractordynamic email extractoremail extractiongather emailemail filteremail sorterbulk email extractor
...consumer, internet marketing, website promotion, search engine optimization, list management and research. You can build business mailing...to extract data from internet using file containing list of urls. You can filter the extracted email...
 
meta tag extractoremail retrieveremail harvesteremail extractorbulk email extractorwebsite crawleremail filterphone fax collectoronline data extractorurl extractoremail extractionemail marketingemail phone fax spider
...to send personalized email to a permission based mailing list directly from Visual Basic, programmable database or spreadsheet....mail with targeted attachments. - Can handle bulk mailing on a distribution list - Can use up...
 
notification softwaremerge emailemail newsletteremail e-zineemail marketingemail sslbulk emailemail softwarepersonalized mailemail listemailerhtml emailemail visual basicpop3smtpsend group mail
Public Duplicate Eraser

Shareware by SDMD GmbH
3 x 2687Kb downloads

...this function is very helpful to avoid your mailing to send the same email a few times...this different criteria’s. You can delete automatically the list of dupes or you can confirm the deletion...
 
outlook 2010dupesoutlook-duplicatemailoutlook-dupeoutlook duplicatedduplicate-foldersoutlook servercontacts2007outlook-duplicatesoutlook-dupeswindows 2008delete duplicatedatesemail
High Speed Verifier

Shareware by EMMA Labs
2 x 3858Kb downloads

...addresses per second. It can easily deal with mailing lists containing tens millions of addresses; moreover, it is...with this list size that the program`s highest performance can be...detects about 20-30% of invalid addresses in a mailing list, though theoretically it is possible to detect...
 
mailing list verifydead emailemails verificationclean mail listemail verificationverify email
Hacker email

Freeware by Hacker email
16 x 1014Kb downloads

...mail directly without using proxies or relays.-Automatically resume mailing if your connection is lost. Hacker Mailer can...automatically dial your modem to connect again.-Excellent email list management tools including the ability to honour removal...values when the email is sent out.-Built-in Email List Verifier so that you can verify emails in...a list before starting a campaign.-Ability to save your emails...for future mail outs.
 
list manageremail listhacker
Wise Bulk Mail Sender

Shareware by newcamel
6 x 2425Kb downloads

...your targeted customer. If you have prepared targeted mailing list, All the rest of work will be...Bulk Mail Sender Lite is a powerful bulk emailing software to design, send and manage personalized messages...be edited easily and saved for later use. Mailing lists management module of software accepts mailing lists generated...HTML formatted email in bulk to your opt-in lists and subscribers, it allows you to include graphics,...
 
emailing solutione-mail marketingsendermailerbulkmass-maileremailerpersonalized emailinge-mailing toolemailing softwarefreeemail marketing softwaremass mailer software