1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...Do you need complete high end email marketing and email follow up system at the...unlimited campaigns *Get detailed campaign statistics *Configure campaign email settings such as from name, from email etc...Html Code for subscription with javascript validation for emails *Send message using any or all of the...two flexible options #Message Queue: Create a queue of messages and specify an interval for the...
 
automatic respondere-mailautorespondersemail supportauto responderautomated emailnewsletter hostingsequential autoresponderautomatic email respondemail deliverabilityemail marketing assistant
Add Email ActiveX Professional

Demo by Traysoft Inc.
24 x 2435Kb downloads

Free Vista Files award
...Easily create and send text or HTML emails with attachments and embedded images from your application....C#, ASP, ASP.NET, Access, Delphi, PowerBuilder, FoxPro etc. AddEmail supports SMTP and ESMTP protocols with optional authentication...version includes high-perfomance multithreaded SMTP engine that can queue and send emails directly to recipient mail servers....
 
activexcontrolbasicvbnetdelphibuilderaspe-mailsmtpocxaspnetvisualpowerbuilderemailcomponent
Add Email ActiveX Enterprise

Demo by Traysoft Inc.
19 x 2435Kb downloads

Free Vista Files award
...Easily create and send text or HTML emails with attachments and embedded images from your application....C#, ASP, ASP.NET, Access, Delphi, PowerBuilder, FoxPro etc. AddEmail supports SMTP and ESMTP protocols with optional authentication...version includes high-perfomance multithreaded SMTP engine that can queue and send emails directly to recipient mail servers....
 
activexvisualvbnetcomponente-mailocxdelphismtpaspnetcontrolbuilderbasicpowerbuilderemail
SMTP Server Pro

Shareware by IM-Soft
40 x 14208Kb downloads

Free Vista Files award
...Server Pro is a powerful easy-to-use SMTP POP3 mail server program designed for satisfying the requirements of...lets you keep the common message queue; user mailboxes and the other components on separate dedicated PCs....available. Using this mode you can check your email clients and other corporate software that relies on...
 
travelserviceenterprisemaildeliverserverblocksmtpinternetattacksperformanceproviderspopserversddosemailsecurity
Enterprise Mail Server

Shareware by Emailarms
33 x 14208Kb downloads

Free Vista Files award
...Enterprise Mail Server is a high-performance SMTP POP3 server program...Providers where having an ultra fast and reliable mail server is vital. It can be used along...with virtually any mailer or email program; it is simple, light-weight, powerful and absolutely...and spammers. Another great feature is that Enterprise Mail Server can be installed on several computers while...
 
serverspopmailattackssecuritydeliversmtpinternettravelperformanceenterpriseemailserviceprovidersblockddos
Corporate SMTP Server

Shareware by Ixis Ltd
35 x 14208Kb downloads

Free Vista Files award
...where having an ultra fast and reliable outgoing mail server is a necessity. It can be used...along with virtually any mailer or email program including Microsoft Outlook, Outlook Express, Eudora, Netscape...installed on several computers while the common message queue can be kept on a separate dedicated PC....mode you can use to check if your email clients work correctly. After you enable the testing...
 
providersemailinternetserverattacksdeliverblockserviceserverstravelenterprisesmtpsecurityperformancepopddos
Complete Mail Server

Shareware by SoftFolder Inc
26 x 1755Kb downloads

...Complete Mail Server is high-performance professional SMTP/POP3 server software engineered...business needs in ultra fast, flexible and reliable mail server. It works along with any email program...or mailer and offers a lot of security features and...restrict the SPAM activity. In case of parallel mail processing, Complete Mail Server can be installed on...
 
sendingmessagesecurepop3fastservicemailerreliableinternetsecurelyemailsmtpgatewayprovidersprogramispsqueueserverscompleteoutlook
...With the ActiveEmail OLE/COM component, you can add and control e-mail...the AUTH LOGIN mechanism. To improve performance, outgoing mails can be queued instead of send them directly,...and processed in the background the ActiveEmail Queue service (with no extra costs). The product also...
 
newsactivexmapismtp e-mail controlsmtp mailemailnntpvisual basic netaspe-mail queuevbscripttools
SqlAnswersMail

Shareware by SqlAnswers.com
20 x 4407Kb downloads

...SqlAnswersMail 3.1.5 Overview SqlAnswersMail is based on the lightweight SMTP protocol, which...works across intranets as well as the Internet. SqlAnswersMail features a redundant mail server configuration where if...a primary mail server fails, the processing is automatically redirected to...a backup mail server. This redundant configuration provides for superb uptime....
 
pdf generatormail queuesmtp emailsql emailxpsendmailsql htmlsql pdfsql mail
Free Vista Files award
...Combine this with the flexible filtering, instant download queue monitoring and detailed log to get the universal...
 
offline explorerweb downloaderwindows exploreroffline browseroffline reader
...Visual C++, Visual C# .NET or VBScript application/tool. ActiveEmail features multiple recipients, embedded attachments, Rich Text Formatting...development tools are provided. To improve performance, outgoing mails can be queued instead of send directly, and...processed in the background the ActiveEmail Queue service (with no extra costs). ActiveEmail can be...
 
activexe-mail queuetoolsnntpsmtp e-mail controlvisual basic netaspemailsmtp mailnewsmapivbscript
AbusePipe Abuse Desk Management Software

Freeware by DataMystic
20 x 431Kb downloads

Free Vista Files award
...Abuse Desk Management Software, Abuse Queue Management Software. Identifies the originating source of email...own networks. Use with KANA and other incoming mail solutions. Advantages- * Far quicker response time to...abuse emails (From 3 weeks down to 1 day or...than spending the majority of it reacting to email abuse * SPAMmers will find your ISP less...basis * Unique data warehouse allows for abuse emails to be analysed via customized reports or...
 
queue managementabuse-queue management toolshelp deskhelp desk tracking systememail tracking softwareabuse mail handling software
...Need a complete high end email marketing and email follow up system without having to pay a...server –Create and Manage unlimited campaigns –Send unlimited emails -Detailed campaign stats¬ -Configure message settings like From...Name, From Email etc -Automatic generation of html code for subscription...with JS Validation -Personalize each email with users Name, Email etc -Mails can be...
 
automatic rss feedsautomated emailsequential autoresponderemail deliverabilityautorespondersauto responderemail supportemail marketing assistantautomatic email respondautomatic respondernewsletter hosting
Personal Mail Server Pro

Shareware by PC-Safety
35 x 14208Kb downloads

Free Vista Files award
...Personal Mail Server Pro is a SMTP/POP3 mail server program you can use as a personal...SMTP server or as a stand-alone fully featured mail server. You can use the product along with...any mail clients that are complaint with the standard SMTP/POP3...protocols. This server does everything from accepting email messages on behalf of your users, storing them...in a queue to sending and receiving them over the Internet....
 
programpopservermailclientssmtppersonalmodeemailmessagedeliveryoptions
Free Vista Files award
...create, send, download, parse and manage e-mails on mail servers (including Gmail and MS Exchange), file system...(mail encryption and signing), HTML mail, XML serialization, mail merge over database, bulk mail, multiple attachments, international...MX lookup (direct send without SMTP relay server), email address validation, ESMTP and POP-before-SMTP authentication, streams, events,...
 
compactdkimsmtpdomainkeyscomponentntlmxmlpopsende-mailapopoutlookspamsmimemail mergebulkpop3imap4dllstreamcomposepstattachmentaspnetsslreceiveencryptmobileparsesignvbnethtmlemail
Free Vista Files award
...MailBee.NET SMTP enables .NET applications to compose, mail merge, send mail to SMTP server (including Gmail...and MS Exchange), submit to IIS SMTP or MailBee Message Queue, or send directly via DNS MX...32/64 bit. Features: - quick methods to send mail with a single line of code; - mail...web page, read/delivery receipt, DSN; - send to MailBee Message Queue or IIS SMTP queue; - direct...
 
queuentlme-mailvbnetaspaspnetsmimemobilerelaysmtpsecureiisattachmentdlldotnetsslcomponentproxyesmtpemailcomposemail mergestreammailingmessagexmlsendcompactgssapidomainkeyshtml
...application that restarts servers on a configurable schedule. Email notifications are available for server prior to reboot...and then after. An email notification is sent out. Allows you to monitor...all your servers from your mail box. Enterprise console management tool allows you to...
 
monitorblue screen deathdirectorylogemailnotifyalertmailsweeperfilemimesweeperscanrunsmtpqueueexecute
...You use the Directory Watch application to monitor a file system and react when a number of files in the directories exceed your threshold. This makes it possible for you...
 
queuemonitorworkflowsmtpexecutealertemailmimesweeperfilescanmailsweeperdirectorynotifyrunlogsecurity
Free Vista Files award
...The ActiveEmail OLE/COM component provides SMTP- and POP3 e-mail functionality...8 bit, quoted-printable, base64). To improve performance, outgoing mails can be queued, and processed in the background...by the ActiveEmail Queue service (with no extra costs). The product also...
 
e-mail queuesmtp e-mail controlemailnntptoolssmtp mailnewsvisual basic netactivexvbscriptmapiasp
Mailwall

Commercial by Omniquad Ltd
21 x 10820Kb downloads

...of e-mail threats before they affect your network. Mailwall will protect your mail domain by receiving inbound...it and forwarding it to your mailserver. Outbound mail can also be configured to be received by...Mailwall from your mail server and delivered by Mailwall after checking it. Mailwall intercepts all e-mail messages...delete or quarantine suspicious messages.
 
filterspam killerpolicymailservermailwallsmtpanti spam