Sort by : ReleasedNameDownloadsAddedRatingRelevance
DM Quest (Direct Mail)

Freeware by Rupean, Inc.
17 x 10131Kb downloads

...Creating, tracking and forecasting Direct Mail and Electronic Marketing with customizable and modular features....There are many ways to create a Direct Mail or Internet marketing campaigns but there is only...
 
quest softwareadvertising codes trackinginternet campaigndirect mail systemadvertising trackingdirect mail reportingdirect mail trackingcatalog paginationcatalog campaign system
Free Vista Files award
...Spamicillin filters out automatically unwanted email and put it in a special SPAMS folder...has ended. Now you can see all your email waiting for you before it gets to your...
 
securit mailemail spammail publicitprotecteur mailnonspamantipubantispammessages envahissantesspamicillinantipopupsprotecteur demailproteger boite mailsendemail
Spam Preventer

Freeware by Ethic Development
23 x 672Kb downloads

...Protects web site e-mails from being harvested by spam bots. The program allows entering e-mail address, web link text, and subject and generates code for a web page...
 
e-mailprotectioneliminatespampreventemail
Mail UnKnown Anti-Spam

Trial by CactusVision Software
16 x 1295Kb downloads

...Stop spam with Mail UnKnown. Mail UnKnown does NOT use spam filters to guess...Validate method giving you full control of the emails you receive. All incoming emails are put on...hold until the sender of the email is first verified. After they are, you have...the option to validate them as an email sender you want to receive emails from. Mail...
 
stopspaminternetemailfilterjunkblockoutlook expressnetscapeutilities

Shareware by XYZSoftware
13 x 674Kb downloads

...Mail Finder is an elegant tool for finding email addresses on a specified domain.It is fast,reliable and...easy to use.It can verify up to 120.000 emails per hour on a standart telephone line connection...have created,Mail Finder Fast also can generate the email addresses to be verified for you.Mail Finder Fast...fully integrated with Mass Mailer(from XYZSoftware).Just grab the email addresses with Mail Finder Fast and send fully.
 
finderemailrelaysearchexchangegrabtcpcommercesmtpverifyfastmassspider
RelayTest

Shareware by DigiArch.org
8 x 1530Kb downloads

...network administrators, that allows to test a specified mail server for open relays. It runs series of...Test Pro is not designed to find vulnerable mail servers - it only scans one server at...
 
spammail serverrblopen relaymail-abusesysteme-mailtestorbsexchangesmtpmdaemonjunkmailsecurity
AddPicker E-Mail Collector

Shareware by Fairlogic Systems
32 x 2982Kb downloads

Free Vista Files award
...AddPicker E-mail Collector is an email extractor utility. It lets users collect names and...
 
extractfoldere-mailemailcollectbookaddressesmessageoutlook expressoe5
WheresJames Outlook Express Archiver

Freeware by WheresJames Software
46 x 1019Kb downloads

...Easily archive mail and newsgroups from Outlook Express. A simple step-by-step...interface guides you quickly through the backup process. Mail and attachments are exported to html format and...
 
outlook expressbackupe-mail
Email Watcher

Demo by Pyxia Development
10 x 838Kb downloads

...that can check an unlimited number of POP3 email accounts. Events and filters can be applied to...the incoming mail to play a wave file, Popup a message...Delete events are especially useful for deleting junk mail or potential viruses. When your computer is online,...determined by you. When your computer is offline, Email Watcher can automatically dial up your ISP to...
 
monitorpop3guardemailalertwatchautomatic
Yahoo! Mail Extract Email Addresses Software

Shareware by Sobolsoft
20 x 760Kb downloads

...Extract email addresses from Yahoo! Mail. Save results as a...
 
spamuniquestripdraftssenderyahooinformationgatheringinboxwebmailharvestingaddressdatabasemarketingstoreemailsgleanoutputextractingsent mailcollectweb emailtrash
EZ Backup IE and Windows Mail Premium

Shareware by Perception
16 x 5382Kb downloads

...EZ Backup IE and Windows Mail Premium makes it easy to backup your favorites,...the backup archive. EZ Backup IE and Windows Mail Premium creates an self-restoring backup archive which includes...
 
transfer windows mailtransfer internet explorerbackup windows mailbackup internet explorerbackup favorites
Li`l MailChecker

Freeware by Neuhaus13 Software
9 x 581Kb downloads

...With this program you can easily check your mailbox for special mails, e.g. from a friend, from...your boss, favorite mailing partner or whoever. If such a mail comes...showing the mail. The advantage is that Li`L MailChecker is small and can run in background so...
 
mailmailboxcheckemail
Webmail Retriever for msn

Shareware by Apocgraphy
14 x 1844Kb downloads

...Send and receive mail through any number of msn accounts using a...real email program! With Webmail Retriever you can access your msn account using...any email program such as Outlook, Outlook Express, Netscape Messenger,...Eudora, or TheBat. Mail arrives in your inbox automatically just like regular...be sorted into folders manually or using your email program`s rules. In addition, you can use your...
 
hotapochttpmailmsne-mailgatewayemailthe batoutlook expresseudorathebatapocgraphy
Webmail Retriever for Hotmail

Shareware by Apocgraphy
21 x 1844Kb downloads

...Send and receive mail through any number of hotmail accounts using a real email program! With Webmail...Retriever you can access your Hotmail account using any email program such as Outlook,...Outlook Express, Netscape Messenger, Eudora, or TheBat. Mail arrives in your inbox automatically just like regular...be sorted into folders manually or using your email program`s rules. In addition, you can use your...
 
e-mailthe batoutlook expressapocgraphygatewaythebathttpmailhotapoceudorahotmailemail
Spamcc

Freeware by Spamcc Software
11 x 7938Kb downloads

Free Vista Files award
...Spamcc is a powerful, safe spam filter. It can help you block spam and pick up useful e-mail from your inbox. Spamcc automatically checks and retrieves your e-mail...
 
e-mail trackere-mail traceranti-spamspam filter
...Hotmailer is a bulk email sender, email address finder and verifier. It can efficiently search...large amount of e-mail addresses from a mail server in a short time. With built in...will connect to the remote server and post email addresses for verification. If the email address is...valid, Hotmailer will automatically send the mail. With a 56K...can expect to send approximately 2000 or more mails per minute....
 
bulk mailerfast bulk mail sender
Eserv Mail Server

Shareware by Etype
19 x 24694Kb downloads

Free Vista Files award
...antivirus API, including ClamAV), content filter, aliases, routing, mail lists, mail robots, control web-interface, WebMail, statistics, unlimited...
 
antispamservereservmailantiviruswindowssoftware
Zmei Mail Sender

Shareware by Zmei Soft
53 x 676Kb downloads

...Zmei Mail Sender is a anonymous , professional high speed...bulk email direct sender program. It is an ideal for...and keeping in touch with clients. Because this mailer works like a mail server, you don`t need...blind relays anymore. As a multi-threaded application, Zmei Mail Sender normal sending speed can up to 500...everyone can set it up in few minutes.Zmei Mail Sender gives you feedback about every message sent,...it now.
 
massbulkanonymousemailsender
...TBS Mail List tracks names and addresses for people you...of Christmas cards sent and received. Will print mailing labels (Avery 8160 - Inkjet) or (Avery 5160...
 
address bookmail listaddress lables

Shareware by GlobalMedia, Inc.
13 x 479Kb downloads

...Gmail, Yahoo!, Hotmail. Real pane of having multiple mailboxes is the need for their contant checking. Don`t...times per day: open web browser or your mail program, remind and enter passwords, wait for slow...username/password information typed automatically, you only see your mailbox contents within a few seconds. No need to...keep email program and web browser open all the time,...
 
yahoo checkermultiple e-mail accountsgmail checkergmail notifierhotmail notifierhotmail checkerpop3 checkeryahoo notifier