1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Sort by : ReleasedNameDownloadsAddedRatingRelevance
NTP Time Server Monitor

Freeware by Meinberg Radio Clocks
104 x 1458Kb downloads

Free Vista Files award
...The NTP Time Server Monitor software allows the user to control and configure the...
 
network time protocoltimeservermonitortime synchronizationntpntp time serverservicestratum
Express Talk VoIP Softphone

Shareware by NCH Software
199 x 684Kb downloads

Free Vista Files award
...Player, VRS Recording System and more. About NCH Software NCH Software is a leader in audio, video,...dvd, telephony, dictation, transcription, business, and computer utility software for Windows, Palm, Pocket PC and Mac OS...
 
sip softphonevoip phonetelephonysoftphone softwaresip phonepbxexpress talkvirtual pbxsoftphone sipcomputer phonecomputer softphoneinternet phone
...Stealth Web Page Recorder is a simple spy software utility for web page recording. This program will...
 
web page loggerinternet loggerinternet monitoringweb page recorderemail recorderinternet loggingemail spyspy mailstealthspy softwareinternet spymail loggerweb mailemail logger
Linspect Commander

Freeware by Linspect
28 x 500Kb downloads

...Linspect Commander is a software utility for Windows. It allows you to execute...or Unix servers over an SSH-secured connection without logging in and running the commands manually. Linspect Commander...
 
scriptfor windowsserverexecutionsecurelinuxcommandsslssh
Access Manager

Freeware by Citi-Software Ltd
98 x 2950Kb downloads

Free Vista Files award
...Access Manager is a free software solution that keeps all your passwords in one,...- Telephone banking codes - E-mail passwords - Software access passwords - Door entry and alarm codes...
 
softwareloggingkeyboardsecuritymanagementpassword managerfreeencryptionloggerpassword managersprivatepasswordssecurefreeware
Free Vista Files award
...available in the Pro and Net version. The software doesn`t record activities, doesn`t require runtimes, doesn`t require...times and projects with the professional time tracking software Visual TimeAnalyzer at www.neuber.com/timeanalyzer - independent of your...
 
analyselogusertime clocktrackingcaptureobserveactivitystealthactivitiesmonitorsupervisionsupervisormonitoringprotocoltime trackingsupervisecontrolloggerspy
MyOdd Desktop Application

Freeware by MyOddweb.com
25 x 2537Kb downloads

...while you were away. With MyOdd Desktop management software you can hide applications at the click of...you choose will stop, start or hide any software you want. With a simple update function you...for maximum protection. Now with MyOdd Desktop management software you can hide applications at the click of...playing more than they really should). -A complete logging system allows you to monitor who used what...
 
windows protectiondesktop managementwindows logshot keysecurity loghotkey
EverWatch Server Monitor

Freeware by AccuSolve, Inc.
20 x 483Kb downloads

...they say it is. Detailed event and statistics logging can optionally be saved to file. Easy to...
 
server monitorfree softwaresite monitoringfreewareinternet toolseverwatchhost monitorserver watch
MAS

Freeware by 3ami
51 x 7297Kb downloads

...all user activity as well as hardware and software audits, it provides all the information you need...are produced with one click. Detailed hardware and software reports, historical system changes are also recorded for...
 
networkcomplianceauditgovernmentbusinessmonitoremployee
EagleEyeOS One

Shareware by EagleEyeOS LLC.
33 x 6989Kb downloads

Free Vista Files award
...cost-effective way, without deep IT knowledge. EagleEyeOS One software available in ten languages; furthermore has got the...
 
storagesloggingdatasecurityfilemonitoringdevicesfilesecurityeagleeyeos
...RS232 Data Logger by Eltima Software is an Open Source application which allows you...Virtual Machines. The utility allows you to disable/enable logging on-the-fly and append incoming data to already existing...
 
free data loggerrecord rs232 datarecord com port datalog datacom port data logger232 data logger
...Backup fast, Restore easy, Files secure, with the new Comodo Backup! Data backup, online storage, scheduling, self-restore, everything you could ever need from your favourite data maintenance software. Main...
 
online backupdisk imagingrescue discpartition backupsynchronizeonline driveregistry backuprecoverydata recoverypartition imagingdocuments backupscheduled backupfreerestoredisk backupmedia backupmail backupincremental
JaBack

Freeware by Hitek Software LLC
32 x 39940Kb downloads

...Free Backup software with advanced automation features. The backup file is...
 
automationautomated synchronizefree backup softwareautomated archivezipftpautomated copy
Blaze ImgConvert

Shareware by Mystik Media
31 x 6613Kb downloads

Free Vista Files award
...also supports naming templates as mentioned below). The software can also be configured to use the source...
 
pcxconvertconversiongifdwfdicomdrwrenameemfimageawdhpglbmpjpggbrmodcaflcfaxdwgpsprotateexifgraphicsexfdcxflidibcmpdcmcolor depthafptifpsdpdfdxfanidgncmxfpxresizegemmulti-pagesgipngcgmcolorspace
AudioCommander

Shareware by Mystik Media
28 x 4578Kb downloads

Free Vista Files award
...The comprehensive range of supported formats makes the software very flexible, and provides a complete solution for...command-line switches for complete control over how the software functions. The software is fully functional and can...
 
ac3ripalacflacencoderawm4amp4adpcmfrequencyconvertwmaoggvoxfreedbcommand-linecommandlinechannelswavpackaiffmp2bitratemp3aacdecodeconversion
...RelayFax Network Fax Server management software automates sending, receiving, and managing your network faxes...intervals and collects waiting fax messages, which the software then emails, faxes, or prints as defined in...commands -- Automatic incoming fax routing -- Extensive Logging -- Smart fax handling USER EXPERIENCE: -- Multiple...
 
network faxfax server softwarefaxingfax managementfax softwaresoftware fax managernetwork faxingfax relayocrfax server solutions
The PC Detective SE

Demo by SCES Software
44 x 3797Kb downloads

...power full spy utility that monitors your PC logging all activity including websites visited, applications run, all...
 
husband cheatingspy softwarewife cheatinginternet blockeractivity recorderrecordingvcrfilteringsurveillancecheating spousespycammonitoring softwareinternet spyinternet monitoring
WinXP Manager

Shareware by Yamicsoft
45 x 5285Kb downloads

...A powerful software tool to tweak, optimize, maintain and tune up...your computer when you`re not at home; Restrict logging on time of any user accounts. WinXP Manager...
 
repairoptimizefixcleanspeedmaintaincustomizetunetweakoptimizationfastertweaker
Secure Clean PC

Shareware by SoftFolder Inc
43 x 1177Kb downloads

...computer surfing the Internet, paying your bills online, logging in with passwords, your PC records the information...
 
usertypetracesstatesuspectsoftwareinformationsecuresystemwindowsversionevidencewipeworkplacepurchasecleanstoredsurfingproblemremovingpasswordsunprotectedcomputerunwantedinternetfeatures
DNS2Go

Demo by Deerfield Communications
17 x 2125Kb downloads

Free Vista Files award
...sub-domain options to choose from. The DNS2Go client software is installed on the computer with which you...want to associate your domain name. The software always knows your computer`s current IP address, and...name into a web browser or other client software will be led to your current IP address....
 
email servicerecorddnsdynamic dnspeerdomain