Sort by : ReleasedNameDownloadsAddedRatingRelevance
Mp3search

Freeware by Mp3 software
350 x 292Kb downloads

...downloads. Because the music files come from ordinary Web sites nobody is peeking on your hard drive...
 
mp3 searchmp3 songsmp3 filesfree mp3 musicmp3 softwarefree mp3 download
Free Download Manager

Freeware by FreeDownloadManager.ORG
1049 x 7039Kb downloads

Free Vista Files award
...world. It lets you download files or whole web sites from any remote server via HTTP, HTTPS,...enhanced audio/video files support, ZIP files preview, browsing web and FTP folders, and more. FDM offers more...is the first social download manager inspired by Web 2.0 technologies. It protects you from malicious or...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
...helps you to promote your software. Free big sites collection is included for your promotion purposes. PAD...
 
promotersubmittertrialwarepromotionsoftwaresharewarefreeware
Sponsored Ad Blocker

Freeware by SuperAdBlocker.com
78 x 3193Kb downloads

...Sponsored Ad Blocker™ protects the relevance of web searches by blocking often misleading and annoying sponsored...
 
browser extensionblockersearch
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...controlled entirely by you not the software The webmasters tool will only pre-populate web pages and not...submit keeping you in control. Comprehensives list of sites to post to including over 160 RSS, PAD,...Blogg, Podcast, Shareware and Freeware sites. With the webmasters tool you will never waste time and money...on targeting the wrong keywords again. The webmasters tool is able to check MSN, Yahoo and...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
Pop-Up Stopper

Freeware by Panicware Inc.
170 x 414Kb downloads

...now with added support for Mozilla, and new technology to block annoying Messenger Service and GAIN adserver...No need to adjust proxy settings, or add sites to a list. Pop-Up Stopper will not strip...
 
stop pop-upsstop popupssurfingx10popup stopperpopup windowspopup killerinternetpop-up stopperfiltereliminate popupspop underpop-up killerpop stopper
...time and bandwidth control; - access control to web sites, by protocols, time, queries, words, etc.; -...category database with more than 3 000 000 web sites; - more than 10 reports visually showing...
 
content filteringweb filteringinternet statisticstraffic controlinternet monitoringinternet access control
...multiple search engines to search a myriad of web sites simultaneously for a more comprehensive Internet experience....for you and your family to search the web for school, work, or just for fun. *...
 
websearchinternetnewssearchfirststopenginemetasearch
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
125 x 4000Kb downloads

Free Vista Files award
...efficient manner. Applications that collect data from RSS-compliant sites are called RSS readers or "aggregators". RSSOwl is...
 
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
Cayman Browser

Freeware by caymanbrowser.com
77 x 1677Kb downloads

...Improve your Internet surfing with this tabbed, innovative Web browser today! Cayman Browser incorporates a large collection...features , it can speak, translate, open multiple web pages at the same time, and more: *Website...MSN - all in one place *Power Group: Login to various web sites, forums, blog servers by...click *Website scan: Check all Urls in a web page and show each url`s create date, file...
 
webbrowser
PixGrabber Free

Freeware by SoftInform
74 x 4296Kb downloads

...Besides, PixGrabber allows arranging image collection without visiting sites themselves. You just have to specify the URL...to start from and the level of image-containing web pages nesting. Also you can download images using...allows adding your personal comments to the current web page and bookmark it straight from the active...easy to avoid useless visiting of the same web pages all the time....
 
image viewerimage browserstopperimage archivebookmark managerpop-up killerinternet surfing
CatsCradle

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...Translate web sites without worrying about the HTML code. CatsCradle is...language translators and translation agencies - a dedicated web page editor that makes it very easy to...translate web pages from one language into another. CatsCradle grabs...all the text that requires translating from a web page, puts it into a built in editor...automatically integrates your translated text back into the web page - leaving all the sensitive HTML code...
 
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml
Avant Browser

Freeware by Avant Force
173 x 4352Kb downloads

...privacy on a shared computer. AutoFills: Forgot a web password? Avant Browser will memorize passwords for you....You can fill web forms with Auto-Filler by a single click. And...you can protect all your web forms with one master password. Flash Animation Filter:...More than 85% of all flash animations on web pages are advertising, and normally take up to...Gestures: If you click a link in the web page with the middle mouse button, the link...
 
sandboxbrowserbookmarktabprivatepopupoperachromeleakavantgesturefillrss
FineBrowser Free

Freeware by SoftInform
71 x 3958Kb downloads

...FineBrowser allows you to view multiple web pages in a single browser window. It includes...annoying popup blocking and clearing any trace of web surfing. The Quick Groups Manager allows you to...you to open multiple links from the selected web page area, or all links within the current...capable to download pictures from Internet without visiting sites using web site’s addresses, image’s URL masks or...single window.
 
pop-up killerinternet explorermultibrowserinternet surfingalternative browserbookmark managerblock pop-up
...Automate your web browser. Record and replay repetitious work. iMacros has...relieves the repetition of checking on the same sites every day, remembering passwords, and filling out web...is the only form filler that can autofill web forms that stretch over several pages. All information...remembers all the rest, and provides true automated logins (a better Single Sign-On). (2) Web Automation iMacros...
 
screen scrapinginternetflashregression testweb scrapingwshagentrecorderfillerautocompletefunctional testingautomatebatchform fillerscriptingsurfingrobotweb testing
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great...websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
SEOSmart Future PR

Freeware by Recovery-Review.com
67 x 464Kb downloads

...checks 94 Google data centers to obtain your Web site`s Google PageRank with a single click. The...a domain name or purchasing links from a Web site? Make sure its PageRank rating is solid...and protect yourself from purchasing links from Web sites with inflated or dropping ratings by checking the...of the site`s PR rating. Monitoring your own Web site? SEOSmart Future PR makes it easy to...CSV export of the query logs.
 
recovery reviewproxysearch engine optimisationpagerank checkerpromotealexafuture pagerankgoogle ranksserptoolsseochataverage pagerank
AlterWind Log Analyzer Lite

Freeware by AlterWind Software
66 x 2271Kb downloads

...AlterWind Log Analyzer Lite is free web log analysis software. It quickly generates all traditional reports....Use this user-friendly software to grab web server logs (all formats supported) and build graphically-rich self-explanatory reports...on web site usage statistics, referring sites, traffic flow, search...phrases and much more! AlterWind Log Analyzer Lite supports 430+ search engines from 120...different countries.
 
alterwindsample reportwebsite statisticsloganalyzerconfiguration stringserver logssite mirrorslog analyzerapachelog analysislog files any format
Blog Navigator

Freeware by Stardock Systems
99 x 1093Kb downloads

...make it easy for users who enjoy reading blogs (short for `web logs`) to read and organize...them. Blog Navigator works by reading RSS feeds and displaying...It includes a host of different news and blog sites for users to read through. Blog Navigator...of its kind and it`s free. For example, Blog Navigator has the ability to pre-load all the...articles on a given blog site to speed up reading. It also has...
 
stardockbloggingcommunicationbrowsingrss feedsinternet
CursorXP

Freeware by Stardock Systems
263 x 2295Kb downloads

...thousands more cursors for you to try at sites like www.wincustomize.com, enough to suit any taste. Can’t...
 
cursorsdesktopfun stufftoyswindows customizationstardock