1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Balthers Graphic Groove Box

Freeware by Balther
41 x 20368Kb downloads

...graphics, Flash, videos and 3D. PC key and MIDI control with interactive real time animated Effects. No...a moving mask effect. 5. An interactive real-time live setup function working on all layers. The trigger...is a MIDI controller and the PC keyboard. Connections for in/output-devices...imbedded in floating palettes like the Properties, the Live and the Tools palettes. The work/show area is...
 
animationreal timemidivideodigital art toolmoving visualsinteractivesoftwareeffect
gmorgan

Freeware by Josep Andreu
124 x 1109Kb downloads

...for play in real time or sequence, full midi configurable, can export live or sequence performances to...BD allows easy new pattern creation, can import MIDI files as patterns, input chords can be controlled...by mouse, PC keyboard or MIDI keyboard. Sound edition, chord song squencer, guided playback...
 
midiboxorganstationaccompanimentdrumrhythmsequencerarrangerstylepattern
Magic Lines

Shareware by Agentix Software
20 x 862Kb downloads

...Magic Lines is one of those cute little games that will never let you be bored. It is a brilliant variation of the popular Lines game with 3D effects. You...
 
lines gamemagic linespuzzle gamelogic gamemagic games
XG-Wizard

Shareware by midiweb.de
55 x 3545Kb downloads

...Remote Control Interface keep your hands on your MIDI keyboard all the time while editing your XG...device # Syx-Transmitter send any message to any MIDI device to setup your complete equipment (not only...a song is performed in a studio or live session # Fader Automatization updates and animates faders,...lfo- und filter graphics in realtime # Integrated MIDI Player now with progress bar, auto-playback, part mute,...
 
cvpmidi editortechnoyamaha psrsw1000xgtyrosraveplg boardsxgworksloopsmusicxgedit
Realistic Virtual Piano VSTi

Shareware by Syntheway
37 x 22020Kb downloads

...this piano will never overload CPU. - Good live performances: never stick notes, never break the sound....having to load up any other plug-ins. - MIDI Automation: Added complete MIDI CC#. ( Syntheway RVP...
 
virtualyamahabasedsynthesizersampledaniel laisecaemulationvstisynthewayrealisticinstrumentmidiacoustic grand pianovst plug-inkawai
PianoFX STUDIO

Shareware by Tanseon Systems
29 x 9146Kb downloads

...Synthesizer for the Personal Computer. You can play live piano music using your PC keyboard or mouse...Professional Keyboard Synthesizer. It produces a ultra-high quality midi sound output with 127 different realistic Musical and...Record and save music compositions as .wav files, MIDI Mapper or Microsoft GS Wave Table Synthesizer, software...
 
songsdigitalplayersheetkeyboardmiditransposerkeysmusicpianoschordssynthesizer
Free Vista Files award
...WAV, and MP3 files and helps create multi-track MIDI (.mid) files containing the notes and drums played,...names, and key. Then you can take those MIDI files and view the notation, change individual notes,...swap or mute instruments. You can also compose MIDI music in real-time by singing or playing any...AIF, AAC, or CD files are converted into MIDI * Rip CD music, convert it to MIDI...(.
 
convertwav midimp3wmaaiffmp3 midinotationaac midiscorewave midiaudio midinotateconvertertranscribedrum miditranscriptionaiff midiscoring
Digital Ear Real-Time

Demo by Epinoisis Software
16 x 4327Kb downloads

...Digital Ear Real-Time can analyze a recorded or live solo performance (e.g. a singing human voice, or...musical instrument) and convert it to a standard MIDI file. That file can be send directly to...that it can capture and send to your MIDI synthesizer, detailed envelope and timbre dynamics events. Those...expression. Think of Digital Ear as your ultimate MIDI controller! * NEW: Now in Real-Time! *...
 
wav2midiconverterwav midiwave midisynthesizeraudio midisequencer
RMCA Realtime MIDI Chord Arranger Pro

Shareware by Michael Brick
33 x 934Kb downloads

...offers all major features of a high quality MIDI keyboard. It comes with chord recognition, based auto...to create an accompaniment style from virtually any MIDI input (MIDI file or live music). Runs from...
 
stickmidifileportablerealtimestylesvirtual keyboardarrangermusic
Professional Metronome

Shareware by Storm Software
13 x 2545Kb downloads

...clients, including song lyrics! This is ideal for live performance when there is more than one computer...can select output device, change lyrics font, change MIDI instrument, switch skins and much more....
 
radartempobar counterbeatplaylistlyricssongsmetronomeprofessional
2Flyer Screensaver Builder Pro

Shareware by 2Flyer.com
38 x 4487Kb downloads

...up to 10,000 images, optionally add MP3, WMA, MIDI sound, and choose from 290 different transition effects....include that you can make screensavers even with live websites, java appletes, and RSS feeds....
 
make screensaverscreensaver builderscreensaver makercreate screensaverscreensaver software
Zuma Pro

Shareware by 3dMaxMedia
44 x 192144Kb downloads

...Performance and Authoring Software. Immediately experience and create Live Interactive 3D VJ Audio-driven music visualizations using these...features: Keyboard controls and Magic Sliders, Full MIDI support, FOR EVERYONE: Have TONS OF FUN as...VISUAL ARTISTS AND PROFESSIONAL VJ’S: Powerful Playlist Editor, LIVE Interactive Performance Recording, Video Export for making 3d...
 
real-time filters effectsvideo jockeyanimation softwarevisual authoringmedia artdancemidi supportraveliveparticle enginevisualizationzuma promotion graphicsarkaos
MIDI Maestro

Shareware by Perspective Software
14 x 12713Kb downloads

...and professional music directors, conductors, and musicians in live musical theater and similar musical accompaniment situations (e.g....color emphasis on beat 1; Click track for live percussionists; Support for external control of software features;...numbering (and lettering) to measures; Full set of MIDI editing tools including quantization and transposition; Record and...
 
musical theatermusic softwaresequencerperformanceconductingmidi wavmidi softwaremidi editorsequencinglive midi
Adventus VST -VSTI

Demo by Softplug.com
23 x 2728Kb downloads

...pads, strings, basses, organs and pianos, whether for live performance work or sequencing …look no further! Cool...Other Features: 6 note polyphonic operation Mono/Legato/Polyphonic control Midi CC control with learn capability 128 high-quality preset...
 
computer musicdemosynthesiscakewalkmusicalplug-insteingbergmusic plugintranceanalog virtual synthesizervst instrumentssoftsynthsfruityloopsanaloguevsti
FlexiMusic Orchestra

Shareware by FlexiMusic
17 x 4424Kb downloads

...beat: You can choose any standard instrument/drum from midi bank. Or you can use sample of wave...home page. Input devices: Computer Keyboard, Mouse, Joystick, Midi and other keyboard. You can use single or...set of music to change over). In a live music orchestra multiple keyboards can be connected to...assigned and changed to change every ones sound. Midi sound: The General Midi (GM) 128 bank instruments...
 
childplay musicsound engineersoftwareplayerdancestagewavegamemixingdiscomousehobbyperformanceinput devicemidi keyboardorchestra
Free Vista Files award
...MP3, WMA, AAC, and AIFF and helps create MIDI (.mid) files containing the notes played, chord names,...and key. Then you can take those MIDI files and view the notation and change individual...notes. You can also compose MIDI music in real-time by singing or playing any...AAC, AIFF, or CD files are converted into MIDI * Rip CD music and convert to MIDI...(.mid) file. Play it in your MIDI keyboard * Play your MIDI synthesizer live by...
 
notationconvertertranscriptionaacnotatewavaudio midiscoretranscribewavewmamp3wav midiscoringmp3 midiaiff midiaac midiwave midi
Free Vista Files award
...MagicScore Maestro 5 + WEB Publishing - professional music notation software with ability to publish "live" sheet music in Internet , offering the most advanced capabilities for working with music and provides you...
 
guitarmusic notation softwarecomposing musicsheet music softwaremusic score editoronlinesheet music programsheet music editormidi keyboardnotation editorchordmusic composermusic notation program
Swift Elite

Demo by TriceraSoft
130 x 33642Kb downloads

...Relay, and Dimmer) Mix Audio, Video, and Karaoke Live & Cue, Preview, or Monitor Multi-Soundcard Support ASIO...Background LIVE! Independent Picture Slideshow Video Montage (BlueScreening/ChromaKey) MIDI Controller Support Numark DMC-1 v2 Controller! Hercules DJ...
 
slide showbinencodekarokecdrwinkaraoke playermmgsoftwrevcdcompressextractwmagmp3 playervideokmfcdgripmp3gstorekaraoke software
...The Virtual Sampler Library (VSL.DLL) provides applications running on Pentium-class PCs under MS Windows 9x/ME/NT/2000/XP with a MIDI-controlled, low-latency, fully programmable wavetable...
 
synthmultimediasamplemidisdkdelphiwavbasicmusicsounddigitalaudio
Mellosoftron

Shareware by Polyhedric Software
13 x 1869Kb downloads

...PC into a sampler which you can play live with a MIDI keyboard, with a sequencer or...with any MIDI file player. Any sound card with a DirectSound...formats (PRGs and WAVs) as WAVmaker and the MIDInight Express, the Mellosoftron is the ideal tool for...
 
soundprgvirtualrenderwavmidisyntheditkeyboardaudiosamplerinstrumentsoft